Details for Lyrate rockcress Locus 16065726

Position : sca3 ( 5`- 7457659 .. 7457060 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065726

Protein [Map View]
MNSEQNQRECIVCREKEPSFIHTVGKTGVFRRLCTDCLLKEYRELFCSVCFNLFDNAVPPQARIICGNCPSSTHLSCSPQ
PLSSSTAASSSSSAPPPASSFTCQPCSNPNFTFFPKSRVNDDVPEETPLSAESAMALIAAAKISVANMNNAVALLKEEAL
KKIIAAKAAKLRAKGALANLQDIVIQKNKATGKRKEDER*

DNA
ATGAATTCGGAACAGAATCAACGCGAATGCATAGTATGCCGTGAAAAAGAGCCGTCGTTCATCCACACCGTCGGCAAAAC
CGGCGTTTTCCGGCGACTCTGCACCGATTGTTTGCTCAAAGAATATCGTGAGCTATTTTGCTCTGTTTGTTTCAATCTCT
TCGACAACGCCGTTCCTCCACAAGCTCGTATCATCTGCGGCAATTGCCCTTCAAGCACCCACCTTTCTTGCTCACCTCAG
CCGCTGTCTTCCTCCACCGCCGCATCTTCATCCTCCTCCGCTCCACCACCAGCTTCTTCCTTCACATGCCAGCCATGTTC
TAACCCCAATTTCACCTTCTTCCCCAAATCTCGTGTCAATGATGACGTCCCTGAAGAAACGCCTCTCAGTGCGGAATCGG
CCATGGCTCTTATCGCAGCTGCAAAGATCTCGGTGGCTAATATGAATAACGCGGTGGCTCTGTTAAAGGAAGAAGCTCTT
AAGAAGATCATAGCAGCTAAAGCGGCCAAGTTGAGAGCTAAAGGTGCATTGGCGAATCTTCAGGATATTGTTATTCAAAA
GAATAAAGCCACCGGCAAGAGGAAGGAAGATGAACGCTGA