Details for Lyrate rockcress Locus 16065551

Position : sca3 ( 5`- 7511827 .. 7512466 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479237 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065551

Protein [Map View]
MSLQRANGHSSSSSSHKKHKTEESDEELLMVPDMEAAGSTCVLSSSADDGVNNPELDTTQNGVSTAKRRRGRNPVDKEYR
SLKRLLRNRVSAQQARERKKVYVSDLESRANELQNNNDQLEEKISTLTNENTMLRKMLINTRPKTDDNH*

DNA
ATGTCTCTTCAACGAGCCAATGGGCACTCGAGTTCGTCTTCTTCCCACAAGAAGCACAAAACTGAGGAAAGTGATGAGGA
GTTGTTGATGGTTCCTGACATGGAAGCAGCTGGATCAACATGTGTTCTAAGCAGCAGCGCCGATGATGGAGTCAATAATC
CGGAGCTTGACACGACTCAAAATGGAGTCTCTACCGCTAAACGCCGCCGTGGTCGAAACCCAGTTGATAAAGAGTATAGA
AGCCTCAAGAGATTGTTGAGGAACAGAGTATCAGCACAACAAGCGAGAGAGAGGAAGAAAGTGTATGTGAGTGATTTGGA
ATCAAGAGCTAATGAGTTACAGAACAACAATGATCAACTTGAAGAGAAGATATCGACTTTGACGAACGAGAACACAATGC
TTCGTAAAATGCTTATTAACACAAGGCCTAAAACTGATGACAATCACTAA