Details for Lyrate rockcress Locus 16065548

Position : sca2 ( 5`- 16591312 .. 16588602 -3` )
Annotation : [B2G] flavodoxin family protein
External links : CoGe
PGDD synteny : 16065548

Protein [Map View]
MSTTSSVRARIAFVALLSATTFYCIHKYRRLKRLKNLSLNPSSTSKPSRGKIFFISQTGTAKALAQRLHELCASNDIAFD
LVDPRSYEPEDLPKENLVLFIASTWDGGKPPKNGEFLVNWLGESAEDFRVGSLLLSDCKFAVFGVGSRAYGESYNAVAKE
LSSRMIGLGGLEMIPVGEGDVDDGELDRAFQDWCGGVIGVLKGGSAEETNGVSQQIGAVENDLEYYDSTDDEDEDNDADG
GIVDLEDIAGKAPSKRNGVVKVTKVDGKKEMVTPVIRASLTKQGYKIIGSHSGVKICRWTKSQLRGRGGCYKHSFYGIES
HRCMETTPSLACANKCVFCWRHHTNPVGKSWQWKMDEPSVIVKGALDLHTKMIKQMKGVPGVTPEKLQEGLNPRHCALSL
VGEPIMYPEINALVDELHGRRISTFLVTNAQFPEKILMMKPITQLYVSVDAATKESLKAIDRPLFADFWERFIDSLKALQ
EKQQRTVYRLTLVKGWNTEELDAYFNLFSIGKPDFIEIKGVTYCGSSATSKLTMENVPWHADVKAFSEALSLKSNGEYEV
ACEHAHSCCVLLGRTEKFKVDGKWFTWIDYEKFHDLVASGESFTSTDYMAQTPSWAVYGAQEGGFDPEQLRYKKERHHHP
KPQAVLA*

DNA
ATGTCAACGACTTCCTCCGTACGTGCTCGAATAGCTTTCGTTGCTTTACTCTCAGCGACGACTTTTTACTGTATCCATAA
ATACCGCCGCTTGAAACGTCTGAAAAACCTCTCGTTAAACCCTAGCTCTACCTCGAAACCCAGCAGAGGAAAGATCTTCT
TCATCTCCCAAACTGGTACAGCTAAAGCCTTAGCTCAACGGCTTCACGAGCTATGCGCATCTAACGACATAGCATTTGAT
CTCGTCGATCCACGGAGCTATGAACCTGAAGATCTCCCTAAAGAAAACCTAGTTTTATTCATCGCGTCGACTTGGGATGG
CGGGAAACCGCCTAAGAACGGAGAGTTTCTTGTGAACTGGCTTGGTGAGAGCGCTGAGGATTTCCGAGTCGGCTCGCTTC
TTCTCTCCGATTGCAAATTCGCTGTTTTCGGTGTCGGGAGCCGTGCGTATGGTGAATCGTATAATGCTGTGGCGAAGGAA
TTGTCGAGTAGGATGATAGGATTGGGTGGACTCGAGATGATTCCGGTGGGAGAAGGCGATGTTGATGACGGAGAATTAGA
CAGAGCATTTCAAGACTGGTGTGGTGGAGTTATTGGGGTTCTGAAAGGAGGTTCTGCTGAAGAAACAAATGGGGTTTCGC
AGCAGATTGGTGCTGTTGAGAATGATCTTGAGTACTACGATTCAACAGATGATGAAGATGAAGACAATGATGCAGATGGA
GGTATTGTTGATCTTGAAGATATTGCTGGAAAAGCTCCTTCGAAGAGAAATGGCGTAGTTAAAGTGACTAAAGTTGATGG
AAAGAAGGAAATGGTGACCCCTGTGATTAGAGCAAGCTTAACGAAGCAGGGCTATAAAATAATCGGTTCGCATAGTGGGG
TTAAGATATGTAGATGGACAAAGTCACAACTTAGAGGCAGGGGAGGTTGCTACAAGCACTCCTTTTATGGCATTGAGAGT
CACAGGTGCATGGAGACAACACCTAGTTTGGCCTGTGCAAACAAATGTGTCTTTTGTTGGAGGCATCACACCAATCCTGT
GGGAAAGAGCTGGCAGTGGAAGATGGATGAGCCGTCTGTGATTGTGAAAGGTGCTCTTGATCTTCATACAAAGATGATTA
AGCAAATGAAAGGAGTTCCAGGTGTAACTCCAGAAAAATTACAAGAAGGTCTAAACCCAAGACATTGTGCGTTATCACTT
GTTGGTGAGCCGATTATGTATCCGGAGATCAATGCCCTTGTAGATGAGCTACATGGAAGGCGTATCTCTACATTTTTGGT
TACTAATGCACAATTCCCTGAAAAGATTTTGATGATGAAGCCTATCACCCAGTTGTACGTAAGTGTAGATGCTGCCACCA
AAGAGAGCTTGAAGGCCATTGATAGACCTCTCTTTGCTGACTTTTGGGAACGGTTTATTGACTCCTTGAAAGCTCTCCAA
GAGAAGCAGCAGCGAACCGTCTACCGTTTAACACTTGTCAAAGGATGGAATACAGAGGAGCTAGATGCTTATTTCAACCT
CTTCAGCATTGGGAAACCTGATTTCATCGAGATCAAAGGCGTCACATACTGCGGATCCTCTGCAACATCAAAGTTGACAA
TGGAGAATGTACCTTGGCACGCAGATGTTAAAGCGTTCTCAGAAGCTCTGTCTCTGAAGAGCAATGGGGAGTACGAGGTT
GCTTGCGAGCACGCCCATTCTTGTTGTGTTCTTCTAGGGAGAACCGAAAAGTTCAAAGTGGATGGAAAGTGGTTCACTTG
GATTGACTATGAAAAGTTCCACGATCTGGTGGCTTCTGGAGAATCATTCACAAGCACAGACTATATGGCTCAAACACCAT
CATGGGCGGTTTATGGAGCACAGGAAGGTGGGTTTGATCCAGAGCAGTTGCGTTACAAGAAGGAAAGGCATCATCATCCT
AAACCACAGGCGGTTTTAGCTTAA