Details for Lyrate rockcress Locus 16065531

Position : sca2 ( 5`- 15925883 .. 15926844 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476500 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065531

Protein [Map View]
MAEDSYEEECDYLFKAVLIGDSAVGKSNLLSRFSKDEFRFDSKPTIGVEFAYRNVHVGDKIIKAQIWDTAGQERFRAITS
SYYRGALGALLIYDITRRTTFDNIKKWLFELRDFANPETVVVLVGNKSDLRQSREVEEDEGKTLAESEGLFFLETSALEN
VNVEEAFLVMIGRIHEVVTQRIASDNKSNGAATAHINGNGNGTVLPVGKEIVNIHEVTATQPLSSSSNCCFK*

DNA
ATGGCAGAAGATTCGTACGAGGAAGAGTGCGACTACTTGTTCAAGGCGGTGTTGATCGGAGACTCAGCCGTCGGGAAATC
AAACCTCTTGTCTAGATTTTCTAAAGACGAGTTCCGGTTTGACTCTAAACCAACCATCGGAGTTGAGTTTGCTTACCGGA
ATGTTCACGTCGGAGATAAAATCATCAAGGCTCAGATTTGGGACACCGCCGGCCAAGAAAGATTTAGGGCAATTACAAGT
TCGTACTACCGTGGAGCATTAGGGGCATTACTGATTTACGACATCACAAGACGAACAACTTTCGACAACATCAAGAAATG
GCTTTTTGAGCTTAGGGACTTTGCCAATCCCGAAACCGTGGTTGTCCTCGTCGGCAACAAATCCGATCTCCGACAATCTA
GAGAAGTCGAAGAAGACGAGGGTAAGACTCTAGCTGAATCAGAAGGTCTCTTCTTCCTCGAGACTTCGGCTTTAGAGAAC
GTTAACGTCGAAGAAGCATTTCTAGTGATGATCGGACGGATACACGAGGTTGTGACTCAGAGGATAGCTTCGGACAACAA
ATCCAACGGCGCTGCGACGGCTCACATTAATGGTAATGGTAACGGTACGGTTCTTCCCGTTGGTAAAGAAATTGTGAATA
TACACGAAGTCACTGCTACTCAACCGTTAAGCTCTTCCTCCAACTGTTGTTTCAAGTAA