Details for Lyrate rockcress Locus 16065495

Position : sca3 ( 5`- 3250469 .. 3252207 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065495

Protein [Map View]
MVGLSLGEQHFVKGGIAQDLRTDGRKRLTYRPIYVETGVIPQANGSARVKIGGTDVIASVKAEIGRPSSLQPDKGKVAVF
IDCSPTAEPTFGGRGGEELSSELALALQRCLLGGKSGAGAGINLSSLLIKEGKVCWDLYIDGLVISSDGNLLDALGAAIK
AALTNTAIPKVNVSAEVADDEQPEIDISDEEYLQFDTSSVPVIVTLTKVGTHYIVDATAEEESQMSSAVSISVNRAGHIC
GLTKRGGSGLDPSVILDMISVAKHVTENLMSKLDSEISAAEAADDES*

DNA
ATGGTGGGGCTTTCTCTTGGGGAACAACATTTTGTTAAAGGTGGGATTGCTCAAGATCTTCGAACTGATGGTCGGAAAAG
ATTGACTTACCGTCCTATCTACGTTGAAACCGGTGTTATTCCGCAGGCTAATGGTTCAGCGAGAGTTAAGATAGGTGGAA
CCGATGTGATTGCTAGTGTAAAGGCTGAAATTGGGAGGCCAAGCTCACTCCAACCCGATAAAGGAAAGGTTGCAGTTTTC
ATTGATTGCAGTCCAACAGCTGAACCGACATTTGGGGGGAGAGGAGGTGAGGAATTGTCTTCTGAGCTTGCTTTGGCTCT
TCAAAGATGTCTTCTGGGTGGCAAAAGTGGAGCAGGAGCTGGAATAAATTTATCTTCGCTTTTAATCAAAGAAGGAAAAG
TTTGCTGGGACCTTTATATTGATGGCCTAGTCATTAGTTCGGATGGGAATCTATTGGATGCCCTGGGTGCTGCCATTAAG
GCTGCTTTAACCAACACGGCCATCCCAAAAGTCAATGTTTCAGCTGAAGTAGCAGATGATGAGCAACCAGAGATTGACAT
CAGCGACGAGGAGTATCTACAATTTGACACTTCCAGTGTCCCGGTCATAGTCACGTTAACAAAAGTGGGAACGCATTACA
TAGTTGATGCAACAGCAGAAGAGGAGTCTCAGATGAGCTCAGCTGTATCGATATCTGTGAATCGGGCAGGCCATATATGT
GGGTTAACCAAACGAGGCGGGTCTGGCTTAGACCCAAGCGTCATCCTTGACATGATCTCTGTGGCCAAGCATGTGACAGA
GAATCTAATGAGCAAACTTGATTCTGAGATTTCAGCTGCAGAGGCAGCCGATGACGAATCTTGA