Details for Lyrate rockcress Locus 16065460

Position : sca3 ( 5`- 8344039 .. 8341325 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065460

Protein [Map View]
MAEQHNKEVIRLEPESVIPILKPKLIMTLANLIEHSNDRQEFLKLCKRIEYTVRAWYLLQFEDLMQLYSLFDPVHGAQKI
QQQNLTSQEIDVLEQNFLAYLFQVMEKSNFKITSNEEMEVAHSGQYLLNLPIKVDESKFSCFWWMKLDKKLLKRYFEEHP
HENIPDFSDKYVIFRRGIGLDKTTDYFFMEKLDVIISRFWSFLMRITRLEKLRAKRSNSLNKKDPKKDDEPNPDTDNDEL
YVERIRLENSKLSVKSFLSKLTIQEPTFDRIIVVYRRASSKTNLERGIYVKHFKNIPMADMEIVLPEKRNPGLTPMDWVK
FLISAVVGLVAVFTSVEMPKSDPWVIIAILSTVLGYCAKTYFTLSAFLFAFSCLHSSLLSEQFLIRKLYSFRFQQNMATY
QNLITQSMYDKQLDSGRGTLLHLCDDVIQQEVKEVMICFYILMEQGKATLEDLDLRCEELIKEEFGARCNFDVEDAVQKL
EKLGIVARDTIGRYYCMGLKRANEIIGTTTEELVLKAKQGVTPS*

DNA
ATGGCGGAACAACACAATAAGGAAGTGATTCGTCTTGAGCCCGAATCTGTCATCCCTATCCTCAAACCTAAACTCATCAT
GACCTTGGCTAATCTCATTGAACATAGCAATGATAGACAAGAGTTCCTCAAGCTCTGTAAGAGAATTGAGTACACTGTTC
GAGCTTGGTATCTTCTTCAATTTGAAGATCTCATGCAACTCTACTCTCTGTTTGATCCTGTACACGGTGCTCAGAAAATC
CAACAGCAGAACTTAACTTCTCAAGAAATTGATGTCCTTGAACAAAATTTCCTAGCTTACTTGTTTCAGGTTATGGAGAA
GAGCAACTTTAAAATAACAAGTAATGAAGAGATGGAAGTTGCACACTCTGGGCAGTATCTTCTAAATCTTCCCATCAAAG
TTGATGAGTCTAAGTTTTCTTGCTTTTGGTGGATGAAGCTTGACAAGAAGCTGCTCAAGAGGTATTTTGAGGAGCATCCA
CATGAAAATATTCCAGATTTTTCTGATAAGTATGTCATCTTCAGACGTGGTATTGGATTGGATAAAACCACTGATTATTT
TTTCATGGAGAAATTGGATGTGATCATTTCACGTTTTTGGTCCTTTCTCATGAGAATCACCAGGTTAGAGAAATTACGCG
CTAAGAGGTCAAACAGTCTTAACAAGAAAGATCCCAAAAAAGATGATGAGCCAAACCCTGACACAGATAATGATGAATTG
TATGTGGAGCGTATTCGCCTTGAGAATTCAAAATTGAGCGTTAAGAGTTTCTTGAGCAAGCTCACAATACAAGAGCCTAC
ATTCGATAGAATCATTGTTGTTTATAGACGAGCTAGCTCTAAAACAAATCTAGAACGAGGAATCTACGTTAAGCATTTCA
AAAACATTCCTATGGCTGACATGGAGATTGTGCTTCCTGAGAAAAGAAACCCTGGACTGACTCCAATGGATTGGGTCAAA
TTTCTGATATCTGCAGTAGTTGGTCTGGTAGCCGTGTTTACTTCGGTTGAGATGCCTAAATCAGACCCATGGGTAATTAT
TGCCATTCTCTCCACAGTGCTTGGTTATTGTGCGAAAACATACTTCACGTTAAGTGCTTTCCTTTTTGCCTTTTCTTGCC
TTCATTCTTCTTTGTTAAGCGAACAGTTTCTTATTCGCAAGTTGTACTCCTTCAGGTTCCAGCAGAACATGGCTACATAC
CAGAACTTGATAACTCAGTCAATGTATGATAAACAACTAGACAGCGGGAGGGGAACGCTGTTACATTTGTGTGATGACGT
GATTCAGCAAGAAGTAAAAGAGGTGATGATTTGCTTCTACATACTAATGGAGCAAGGGAAAGCTACCTTGGAGGATCTGG
ATTTGAGGTGCGAGGAACTGATAAAGGAAGAGTTTGGTGCGAGGTGTAACTTTGATGTAGAAGATGCAGTCCAGAAGTTA
GAGAAGTTGGGGATCGTTGCTCGGGACACCATTGGAAGGTACTACTGCATGGGGCTGAAGCGAGCCAACGAGATTATAGG
GACTACCACGGAGGAGCTTGTCCTCAAGGCCAAACAGGGCGTCACCCCTTCTTGA