Details for Lyrate rockcress Locus 16065442

Position : sca3 ( 5`- 3029790 .. 3026650 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065442

Protein [Map View]
MEETSDRLNPGITPEFDPKTMRSTKPGLKRLFITTSVLFSFLLGVPFLWKSVEIYRSPLPFHDIDSLSDQIESTPLRFPC
NFHAVFVGFPSTDPDNLRSQIQDGINQLTHQNSQCGSCNFSLSVTVQNRDDQCSETLAHSSTTCSYRCGVIKRNVFGVGV
DDTVDESLNDVFSGCSEESGKVYSVVVVNKENANGGDEVKAVVGKRRHAWIVGNGLEERYGDMVARVSEIFVKVFMTGGR
DEDSIQGEFMPVGSDGRIVLSFSLLNSNPRDWVYDWDFQRIDEALLAPVTKALAPIANISVESQVLYHTPKSSFSSWDKK
LQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGKECPLLLQLPNGEISKTNGFISPMWGGVIVWNPGNC
DKDSESPSRNTISPQDLEQIVEIFLGQFRQLFGFKSEAIYTSGLGTYKILPSERGFTEWELDVLSRKHTCFNLHSCSTTL
GSLSRLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPSIMSVSYFSYEHCFAVY
SPFFLPVAGHVVLAALREWRRYKQEKAKYLTWLTRKKTA*

DNA
ATGGAAGAAACCTCCGATCGTCTGAATCCGGGAATCACGCCGGAGTTTGATCCGAAGACTATGCGTTCTACCAAACCTGG
ATTGAAGCGTCTCTTCATCACCACCTCTGTACTCTTTTCATTCCTTTTAGGTGTGCCATTTCTGTGGAAGTCAGTGGAAA
TATATCGCTCTCCGTTACCGTTCCACGACATCGATTCGCTCTCCGATCAAATTGAGTCTACTCCTTTGCGTTTCCCTTGC
AATTTCCACGCTGTATTCGTCGGTTTCCCATCGACGGATCCGGATAACTTACGATCTCAGATACAAGATGGTATAAATCA
GTTAACTCATCAAAATTCACAATGTGGTTCCTGCAATTTTTCCCTCTCTGTCACCGTTCAGAACCGAGATGACCAATGCT
CTGAAACACTTGCTCACAGTTCTACCACGTGCTCTTACCGTTGTGGAGTGATCAAAAGAAATGTTTTTGGTGTTGGAGTG
GATGATACAGTGGATGAGTCTTTGAATGATGTGTTTAGTGGCTGTTCTGAGGAGAGTGGGAAAGTGTACAGTGTTGTTGT
GGTGAATAAAGAGAATGCCAATGGTGGGGATGAGGTAAAAGCTGTGGTGGGCAAGCGAAGGCATGCGTGGATTGTGGGGA
ATGGATTAGAAGAAAGATATGGTGACATGGTGGCTAGAGTTTCTGAGATTTTCGTTAAGGTGTTTATGACTGGTGGAAGA
GACGAAGACTCAATTCAGGGAGAGTTTATGCCTGTTGGATCAGATGGGAGGATTGTTCTTTCGTTCAGTCTATTAAATTC
TAATCCACGTGATTGGGTCTACGATTGGGACTTTCAAAGGATAGACGAGGCATTGTTGGCTCCAGTGACTAAGGCCTTAG
CACCTATAGCTAATATAAGTGTTGAAAGTCAGGTTTTGTATCATACACCGAAGTCTTCTTTTTCATCTTGGGATAAAAAA
CTTCAGAGCTACATCTTTAGGACCAGTGATCTTCCCTTTTTCGTGAATTCGAACGAATGGCACTTGGATACTTCTGCTGG
AGCCAGTGGACGGTCCAAAATACTGCAATTTGTGGTATATATTCCATCCGGAAAAGAATGCCCTCTTCTTTTGCAGTTAC
CAAATGGGGAGATATCTAAAACAAATGGCTTCATATCTCCGATGTGGGGCGGTGTGATTGTGTGGAACCCGGGAAATTGT
GACAAGGACTCTGAAAGCCCAAGTCGGAACACGATATCGCCTCAGGATCTCGAGCAAATAGTTGAAATTTTCTTGGGACA
ATTCCGACAACTATTTGGCTTTAAGTCTGAAGCCATTTATACCAGTGGATTGGGCACTTACAAGATTTTACCTAGTGAAA
GAGGCTTTACAGAGTGGGAATTGGATGTCTTGTCACGGAAGCACACATGCTTCAATCTCCATTCTTGTTCAACAACCCTC
GGTTCTCTCTCTAGATTGGTTCGGTCACTCCCCAGGATGATTATCAAGGATGAAATTGGAGAACAAGTGAAATATTCTCT
GAAAGCAGCAAAGTTGGCTCAGTCTAATGCTTCTTTGGGAGGATACAGTTCTTCAGCCAGTTCATCAAGAGAAGCAAGGT
CTCTAGCCGAGAATGCCTTCTTCCATCCATCCATCATGTCCGTCAGCTACTTCTCTTATGAACATTGCTTTGCAGTGTAC
TCACCATTTTTCCTGCCCGTGGCAGGACACGTTGTCCTTGCAGCACTACGAGAATGGAGGAGATACAAACAAGAGAAGGC
AAAGTACTTGACATGGCTAACCAGAAAGAAGACGGCCTAG