Details for Lyrate rockcress Locus 16065434

Position : sca3 ( 5`- 6036239 .. 6033022 -3` )
Annotation : [B2G] ubiquitin-specific protease 25
External links : CoGe
PGDD synteny : 16065434

Protein [Map View]
MGFKLQMSWMPSLLSQKRRNGPPLGLRNLGNTCYLNSVLQCLTFTPPLANFCLTHKHSSHCDSYVDGERKRDCPFCIVEK
RIARSLSVDLTTDAPNKISSCLKIFAEHFKLGRQEDAHEFLRYVIDACHNTSLRLKKLRIKGNEPFNGNTVVKEIFGGAL
QSQVKCLSCGAESNKADEIMDISLEILHSSSVKESMQKFFQSEILDGNNKYKCETCEKLVTARKQMSILQAPNILVIQLK
RFGGIFGGKIDKAISFGEILVLSNFMSKASKDPQPEYKLFGIIVHSGFSPESGHYYAYVKDSLGRWYCCNDSFVSLSTLQ
EVLSEKAYILFFSRSNQRPASAKTLVTSNGTTSHEVNGCETSNPQKFIGPLNGVNMKPQSEQSFQKVKLASSKPHKFIGP
KLRAEQALQEDNLLSSKVEKAPLKPHAKVIISVNLGAKRVSPSVNGRLSFHQDENIAPKANKENSVSVLPTRVKSGTERK
FGTENGGNGVKENGSAPGSSNHKVTVHPHERSNGSCNGGDHYKDNLHPCGSNGSQNGTVHQEIERNGVSTTQSKGLCSST
NEDPCILLRKDESSRNELEAIKESLKKDALSHLRSCGWYDKVHISMRAKKRLRTEQSGGEDGNDLKRLLIEDVKSSLKSQ
IPEGLKADLVNRIWEISKKKYS*

DNA
ATGGGATTTAAACTGCAGATGAGCTGGATGCCGAGTCTACTGAGTCAGAAGCGTAGGAATGGTCCTCCCTTAGGGTTACG
GAATCTCGGCAACACCTGTTACCTCAATAGTGTCCTTCAGTGTCTCACTTTCACTCCTCCTCTCGCTAATTTCTGCCTTA
CTCACAAACACTCCTCTCACTGTGACTCATATGTGGATGGGGAGAGGAAACGGGATTGTCCATTTTGCATAGTTGAGAAA
AGAATAGCAAGGTCTCTTAGTGTGGATCTAACAACCGATGCGCCTAACAAGATTTCAAGCTGTCTCAAAATTTTTGCTGA
GCATTTTAAGCTTGGGCGTCAAGAGGATGCTCATGAGTTCTTGCGGTACGTCATTGATGCATGCCACAATACGTCTCTCC
GCCTCAAGAAGTTGAGGATCAAGGGTAATGAGCCCTTTAATGGCAATACTGTCGTCAAGGAGATTTTTGGTGGTGCTTTG
CAGAGCCAGGTCAAGTGTTTGTCATGTGGTGCCGAGTCTAATAAAGCCGATGAGATTATGGATATCAGTCTTGAGATTTT
GCATAGTAGCTCTGTCAAGGAGTCTATGCAAAAGTTTTTTCAATCAGAGATTTTAGATGGCAACAATAAGTATAAATGCG
AGACCTGCGAAAAACTGGTGACGGCGAGGAAGCAGATGTCTATACTCCAAGCGCCTAATATCCTTGTTATCCAATTGAAA
AGGTTTGGGGGTATTTTTGGTGGGAAGATTGATAAAGCCATTTCATTTGGTGAGATTCTGGTTCTCTCGAACTTCATGAG
TAAAGCAAGCAAGGACCCTCAACCGGAATACAAGCTTTTTGGGATAATTGTGCACTCAGGATTTTCTCCTGAATCTGGGC
ACTATTATGCATACGTTAAGGATTCCTTGGGTAGATGGTATTGCTGCAATGATTCGTTTGTCTCGCTCTCCACCTTGCAG
GAGGTTTTATCAGAGAAAGCTTATATCCTGTTTTTCAGCCGTTCAAACCAGAGGCCAGCGTCTGCTAAAACTCTGGTAAC
ATCCAATGGGACTACATCTCATGAAGTTAATGGCTGTGAGACATCAAATCCCCAGAAGTTTATTGGGCCCCTTAATGGTG
TCAACATGAAACCACAATCCGAGCAGTCCTTCCAGAAGGTAAAACTGGCTTCTTCAAAGCCCCATAAATTTATTGGGCCC
AAACTACGAGCCGAGCAGGCCCTCCAAGAGGATAACCTGCTTTCTTCCAAAGTTGAAAAGGCGCCTTTAAAGCCACATGC
GAAAGTCATTATATCTGTCAACCTTGGTGCCAAAAGGGTCTCTCCTTCTGTCAATGGTAGACTTTCTTTCCACCAAGATG
AGAACATAGCTCCAAAAGCGAACAAAGAGAATAGTGTATCAGTTTTGCCGACTAGAGTTAAGTCTGGCACGGAGAGAAAG
TTTGGTACTGAAAATGGTGGCAATGGAGTTAAAGAAAACGGCAGTGCACCAGGTAGTAGTAATCATAAAGTGACAGTGCA
TCCCCATGAGCGTAGTAATGGCTCCTGCAATGGGGGTGATCACTACAAGGATAACTTACATCCATGTGGAAGTAATGGCT
CACAAAATGGAACTGTTCACCAGGAAATTGAGAGGAACGGTGTTAGTACCACCCAATCCAAAGGCTTGTGTTCTTCAACA
AATGAAGACCCCTGCATTTTGCTTAGAAAAGACGAATCATCTCGGAATGAACTTGAAGCAATCAAAGAGAGCCTGAAGAA
AGATGCGTTGTCACATCTACGGTCATGCGGATGGTATGACAAGGTACACATCTCCATGCGGGCCAAGAAGAGATTGCGTA
CAGAGCAATCAGGAGGAGAAGATGGTAACGACTTAAAGAGGTTGTTGATTGAAGATGTGAAATCAAGTTTAAAATCGCAG
ATTCCAGAGGGATTGAAAGCAGATCTGGTAAACCGTATATGGGAAATTAGCAAGAAGAAGTACTCGTGA