Details for Lyrate rockcress Locus 16065423

Position : sca3 ( 5`- 9876054 .. 9875678 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065423

Protein [Map View]
MEGLSHIALPVLGIVAVSVVTFYAVSFAEIREKSFKDVYDSENEVGFKTSLSSRERRSRREANKKRPRS*

DNA
ATGGAAGGGCTAAGTCATATCGCACTCCCTGTTCTTGGAATTGTCGCAGTCTCCGTCGTAACCTTCTATGCCGTTAGCTT
TGCCGAGATCAGAGAGAAATCGTTTAAAGATGTGTACGACTCGGAAAATGAAGTTGGGTTCAAGACTTCTCTAAGTTCAA
GGGAGAGAAGATCAAGAAGAGAAGCAAATAAAAAACGCCCTCGATCTTGA