Details for Lyrate rockcress Locus 16065407

Position : sca3 ( 5`- 9425639 .. 9422096 -3` )
Annotation : [B2G] ubiquitin carboxyl-terminal hydrolase 7
External links : CoGe
PGDD synteny : 16065407

Protein [Map View]
MLTVSVKWQKKVFESIEVDTLQPPYVFKAQLYDLSGVPPERQKIMVKGGLLKDDADWSTLGLKNGQKLMMMGTADEILKA
PENGPVFMEDLPEEEQAANLGYSAGLVNLGNTCYMNSTMQCLKSVPELKSELSNYQSARTKDVDQTSHMLTVATRELFSE
LDKSVKAVAPMPFWMVLQKKYPQFAQLHNGNHMQQDAEECWTQMLYTLSQSLKPPSPTEDPDAVKALFGLNLRSRLHCQE
SSEESSETESVFSLKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYIKESLIDSLPRYLTVQFVRFFWKRESNQKA
KILRKVDYPLELDVYDLCSEDLRKKLKAPRQKLRDIEGQKLGLQASAKSSSKGDDVKMTDAEGSSNGSGELSSGDQPGGA
SSHMTGIYDLVSVLTHKGRSADSGHYVSWVKQESGKWVQYDDANTSLQREEDITKLSGGGDWHMAYIVMYKARLISM*

DNA
ATGTTAACAGTGAGCGTGAAGTGGCAAAAGAAGGTGTTTGAGAGTATCGAGGTCGATACTCTCCAGCCTCCTTATGTTTT
CAAGGCTCAGTTGTATGATTTAAGTGGAGTACCGCCTGAGCGGCAAAAGATAATGGTCAAAGGTGGACTTTTGAAGGATG
ATGCAGATTGGTCTACGTTGGGACTCAAAAATGGTCAAAAATTGATGATGATGGGAACTGCAGATGAAATACTCAAGGCT
CCAGAGAATGGTCCTGTTTTTATGGAGGATCTTCCTGAGGAGGAACAAGCCGCTAATCTGGGTTACAGTGCTGGCCTAGT
CAATCTTGGAAACACCTGCTACATGAACTCAACGATGCAGTGTTTAAAATCTGTCCCAGAGTTGAAATCTGAATTATCCA
ATTACCAATCTGCTCGAACCAAGGATGTTGATCAGACTTCTCACATGCTCACAGTTGCAACACGTGAGTTATTTAGTGAG
CTTGATAAAAGTGTCAAGGCTGTTGCGCCTATGCCATTCTGGATGGTGTTACAAAAAAAATATCCTCAGTTTGCTCAGTT
GCATAACGGAAATCACATGCAACAGGATGCTGAAGAATGTTGGACACAAATGTTGTACACTCTTTCCCAGTCCCTAAAAC
CGCCATCGCCTACCGAAGATCCTGATGCTGTGAAGGCTCTTTTTGGTCTCAACCTTCGTAGCAGGTTGCATTGCCAAGAA
AGTAGTGAAGAAAGCTCGGAGACAGAATCTGTCTTTTCTCTGAAATGTCACATATCACATGAGGTGAACCACTTGCATGA
AGGATTAAAACATGGACTGAAAGGAGAACTTGAAAAAACATCTCCTGCTCTGGGTCGTACAGCGGTTTACATTAAGGAGT
CTCTTATAGATTCGTTGCCAAGGTACCTGACTGTTCAGTTTGTGAGATTTTTCTGGAAACGGGAGAGTAATCAGAAAGCA
AAAATTCTCCGGAAAGTGGATTATCCGTTGGAGTTGGATGTATATGACCTTTGTTCTGAGGATCTTCGAAAGAAACTGAA
AGCTCCTCGGCAGAAACTGAGAGATATTGAAGGTCAAAAGCTTGGTCTGCAAGCCAGTGCAAAGAGCAGCTCAAAGGGCG
ATGATGTGAAAATGACTGATGCTGAGGGATCATCAAACGGAAGTGGTGAGTTATCCTCCGGTGACCAACCTGGAGGTGCT
TCGTCTCACATGACCGGAATTTATGACCTGGTCTCAGTTTTGACCCACAAAGGCAGAAGCGCAGACTCTGGGCATTATGT
TTCATGGGTCAAGCAAGAGAGTGGTAAGTGGGTTCAATACGACGATGCTAACACGAGCCTTCAACGGGAAGAGGATATCA
CTAAACTCTCTGGAGGAGGTGATTGGCATATGGCATACATCGTAATGTACAAGGCCCGTCTCATCTCCATGTAA