Details for Lyrate rockcress Locus 16065385

Position : sca3 ( 5`- 9956404 .. 9955311 -3` )
Annotation : [B2G] ATRPABC24.3 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065385

Protein [Map View]
MLTEEEIKRLYRIQKTLMQMLKDRGYFIADSELTMTKQQFIRKHGDNMKREDLVTLKVKRNDNSDQLYIFFPDEAKVGVK
TMKMYTNRMKSENVYRAILVVQQNLTPFARTCISEISSKFHLEVFQEAEMLVNIKEHVLVPEHQVLTTEEKKTLLERYTV
KETQLPRIQVTDPIARYFGLKRGQVVKIIRPSETAGRYVTYRYVV*

DNA
ATGTTGACGGAAGAAGAAATCAAAAGACTGTACAGAATCCAGAAGACGTTGATGCAGATGTTAAAGGATCGTGGCTATTT
TATAGCAGATTCTGAACTAACGATGACGAAACAACAGTTTATTAGGAAACATGGTGATAACATGAAAAGAGAGGATCTTG
TTACTCTTAAGGTTAAGAGAAATGATAACAGTGATCAGCTCTACATTTTCTTCCCGGATGAGGCGAAAGTTGGAGTGAAG
ACGATGAAGATGTACACGAACAGGATGAAATCAGAGAATGTGTACAGAGCTATTTTGGTTGTGCAACAGAACTTGACCCC
TTTTGCTCGAACTTGCATTAGTGAGATCTCTTCAAAGTTTCATCTGGAAGTTTTCCAGGAGGCGGAAATGCTAGTGAACA
TTAAAGAACATGTTCTTGTTCCTGAGCATCAAGTTCTTACCACTGAAGAGAAGAAAACTTTACTGGAGAGATACACAGTG
AAGGAGACACAGCTTCCAAGGATCCAAGTGACTGATCCAATCGCAAGATACTTTGGACTAAAACGTGGGCAAGTCGTGAA
GATCATTCGTCCTAGTGAAACTGCTGGTCGTTATGTTACCTATCGTTATGTTGTATAA