Details for Lyrate rockcress Locus 16065374

Position : sca3 ( 5`- 5967686 .. 5967429 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897699 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065374

Protein [Map View]
MTEKCFLIGIIIFFLSQSQTVTCFTEDFEFLKKISCELTPKVTVAAEGSGDFFTITAGLVAISKKNGRVVIHVKAGLYAE
NVVIT*

DNA
ATGACCGAAAAATGCTTTCTCATTGGAATCATCATCTTCTTTCTATCACAGTCACAGACTGTAACTTGTTTCACTGAAGA
TTTTGAGTTCTTAAAGAAGATCAGCTGCGAGCTCACTCCGAAAGTTACCGTTGCGGCTGAGGGCTCCGGAGATTTCTTCA
CGATCACGGCAGGTCTAGTCGCAATATCTAAGAAGAATGGTAGAGTTGTGATACACGTTAAAGCTGGACTTTACGCCGAA
AACGTTGTCATCACATGA