Details for Lyrate rockcress Locus 16065368

Position : sca3 ( 5`- 4723961 .. 4725417 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065368

Protein [Map View]
MARFLLLCYLFAAVLTSSLTEAGDNNQVYSPCSDSTVAIGDGFTFGIAFAARDSFFSTNRSDHVQYSPCDRHRLSLNGNS
EVAVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSIPIMVADSNHIVTSFTLVLEFQKGRLEEMFWKKD
GCSKCSGDSKFVCLNKEECAIKTQSCKNQGGQVDCSLGIQLAFSGTDKHYTALNSWYEVANLKQYSLYGLYSNLKDSLTN
PFKNIF*

DNA
ATGGCTAGATTCCTTCTTCTTTGTTACCTCTTCGCGGCGGTGCTAACGTCATCATTGACGGAGGCCGGCGACAATAATCA
AGTCTACTCGCCTTGTTCAGATTCTACTGTTGCGATCGGCGATGGATTCACTTTCGGCATTGCCTTCGCGGCGAGAGATT
CTTTCTTCAGTACAAATCGTTCCGATCATGTTCAATACTCTCCCTGCGATCGTCACCGTCTCTCGCTCAACGGTAACTCT
GAGGTCGCCGTGTTCAGACCTAAAGTCGATGAGATCACTCTCCTTACCATCAATACCTCTAGTTCCTCCAGTTTCCGTCC
GGATGCTTCAAAGGGATATATGGTAGCATTCGCTGGTGCAAAATACGCTGCAAGATCAATCCCAATTATGGTTGCAGACA
GCAATCACATCGTGACAAGCTTCACCCTTGTTCTTGAGTTCCAGAAGGGCAGGCTTGAGGAAATGTTCTGGAAAAAAGAC
GGATGCTCGAAATGTTCTGGAGATTCGAAATTCGTGTGCCTCAACAAAGAAGAATGTGCAATCAAGACGCAAAGCTGCAA
GAACCAAGGAGGACAAGTAGATTGTAGCTTGGGGATCCAATTGGCGTTTTCAGGCACGGATAAGCACTACACTGCGTTGA
ATTCGTGGTATGAGGTTGCAAATCTGAAGCAGTACTCGCTCTATGGCCTCTACTCCAATCTTAAGGACTCACTAACCAAC
CCATTCAAAAACATCTTCTGA