Details for Lyrate rockcress Locus 16065330

Position : sca3 ( 5`- 6462584 .. 6466555 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065330

Protein [Map View]
MDRILKAARTSGSLNLSNRSLKDVPIEVYQCLETTGEGENWWEAVDLQKLILAHNDIAVLREDLKNLACLVVLNVSHNNL
SQLPAAIGELTAMKSLDVSFNSITELPEQIGSAISLVKLDCSSNRFKELPESIGRCLDLSDLKASNNQISSLPEDMVNCS
KLSKLDVEGNRLTALSENHIASWTMLTELNASKNMLSGLPQNIGSLSRLIRLDLHQNKILSVPPSIGDCSSLVEFYLGIN
SLSTLPAEIGDLSRLGTLDLRSNQLKEYPVGACKLKLSYLDLSNNSLTGLHPELGNMTTLRKLVLVGNPLRTLRSSLVNG
PTAALLKYLRSRLSNSEETSASTPTKENVIASAARMSISSKELSLEGLNLSAVPSEVWESGEITKVNLSKNSIEELPAQL
STSVSLQTLILSRNKIKDWPGAILKSLPNLVCLKLDNNPLTQIPLDGFQAVSGLRILDLSGNAVSFREHPKFCHLPQLQE
LYLSRIQLSEVPEDILNLSNLIILDLNQNSLQSIPKSIKNMTSLKHLDISNNNISSLPPELGLLEPTLEVLRLDGNPLRS
IRRPILERGTKAVLNYLKDRLPDQ*

DNA
ATGGATCGGATTCTGAAAGCGGCTCGAACGTCTGGTTCGCTGAATCTTTCCAATCGCTCTCTCAAGGATGTACCTATTGA
GGTATATCAATGTTTGGAAACGACCGGAGAAGGAGAAAACTGGTGGGAGGCTGTTGATTTGCAGAAGTTGATCTTGGCTC
ATAATGACATTGCGGTTTTAAGAGAAGATCTGAAGAACCTTGCCTGTTTGGTTGTGCTAAATGTCAGTCACAATAATCTC
TCTCAACTTCCAGCAGCTATTGGGGAGCTTACTGCGATGAAGTCTTTGGATGTGTCTTTTAACTCTATAACAGAACTTCC
TGAACAAATTGGTTCAGCAATTTCTCTTGTCAAGCTTGACTGTTCAAGCAATCGGTTTAAAGAATTGCCAGAATCTATTG
GGAGATGTTTAGACTTATCCGATTTGAAGGCCTCAAATAATCAAATTTCCAGTTTGCCAGAAGACATGGTGAACTGTTCG
AAATTATCTAAACTGGATGTGGAGGGAAACAGGCTCACAGCTCTCTCTGAGAACCACATAGCATCATGGACCATGCTTAC
AGAACTTAATGCATCGAAGAATATGCTGAGTGGTCTGCCACAAAATATCGGAAGCCTTTCGCGTCTTATTAGGCTTGACC
TTCATCAGAACAAAATCTTGTCTGTTCCACCATCAATAGGCGATTGCTCCTCTCTTGTGGAGTTCTATTTGGGAATTAAC
TCGCTATCAACATTACCAGCCGAGATTGGAGATCTATCACGTCTAGGAACATTGGATCTTCGTTCTAATCAACTCAAGGA
ATATCCAGTTGGGGCATGTAAATTGAAGCTCTCGTACCTAGATCTTTCAAATAATTCCTTGACAGGATTGCATCCTGAGC
TCGGAAACATGACTACTCTGAGAAAGCTTGTGCTTGTTGGCAATCCTTTGAGAACTCTTAGAAGCTCATTAGTAAATGGT
CCTACAGCTGCTCTATTGAAGTATCTTAGGAGCCGCCTTTCTAATAGTGAAGAAACAAGTGCAAGCACTCCAACAAAGGA
AAATGTGATTGCTTCAGCAGCTCGTATGTCCATTTCTTCAAAGGAACTTTCTCTGGAAGGTCTCAACTTGAGTGCTGTCC
CTTCAGAAGTTTGGGAATCTGGTGAGATCACGAAAGTTAATCTTTCTAAGAACTCTATCGAGGAATTGCCTGCTCAACTT
TCTACATCTGTTTCCCTTCAGACTTTAATTTTGTCAAGGAACAAGATTAAAGATTGGCCTGGTGCAATCTTGAAGTCACT
TCCCAATCTTGTGTGCTTGAAGTTGGATAATAATCCCCTGACGCAGATTCCACTGGATGGGTTTCAAGCAGTCTCTGGGC
TTCGGATTCTAGACCTAAGTGGTAATGCAGTTTCCTTCAGAGAGCATCCTAAGTTTTGCCACTTGCCACAACTGCAAGAG
CTTTATTTGAGTCGAATCCAGCTATCTGAAGTCCCTGAAGATATTCTCAACTTATCTAACCTGATTATCCTTGACTTGAA
CCAGAATTCACTTCAATCGATTCCGAAGAGTATCAAGAACATGACTTCACTCAAACATCTGGACATATCCAACAACAACA
TTTCGAGTCTTCCTCCAGAACTGGGTTTGCTTGAGCCTACACTTGAGGTTCTACGACTTGACGGGAACCCATTAAGAAGC
ATCAGGAGGCCAATTCTAGAAAGAGGAACGAAAGCTGTGTTGAACTACCTGAAAGACAGACTTCCAGATCAGTAG