Details for Lyrate rockcress Locus 16065306

Position : sca3 ( 5`- 6117075 .. 6118304 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065306

Protein [Map View]
MIIRRLVLFAASNSNPGRPQSLSASTVRLLSSSSSDRYTPSSQRYSGDDKLARLKHKDWLAPNEVLKIFENVKDPSFLMP
AYQHYSKRKDYQPTESLYALLINKFGQAKMFDEIEEVMSTIKLEKRCRFSEDFFYNLMRIYGNLAGRINRAIEILFGMPD
FGCWPSAKSFNFILNLLVSAKLFDEIHKIFVSAPKLGVEIDACCLNILIKGLCESGNLEAALQLLDEFPKQKSRPNVMTF
SPLIRGFCNKGKFEEAFKLLERMEKERIEPDTITFNILISGLRKKGRVEEGIDLLERMKLKGCEPNPGTYQEVLYGLLDK
KRNLEAKEMMSQMISWGMRPSFLSYKKMVLGLCETKSVAEMDWVLRKMVNHGFVPKTGMWWKAVCCVVSKNNDSQANLDR
ITAGKETPG*

DNA
ATGATTATTCGGAGGCTGGTTCTATTTGCAGCATCGAATTCAAATCCCGGACGGCCTCAATCACTTTCCGCTTCTACTGT
TCGACTTCTCTCATCATCATCTTCGGATAGATATACGCCGTCGTCGCAACGATACTCCGGTGACGATAAGCTCGCTAGGC
TAAAGCACAAAGATTGGTTAGCCCCAAACGAGGTTTTGAAAATCTTCGAGAATGTCAAAGATCCGAGCTTTCTGATGCCG
GCTTACCAACATTACTCTAAACGTAAAGATTATCAACCGACGGAATCTCTCTACGCCCTTCTGATCAACAAGTTTGGACA
AGCTAAAATGTTCGATGAAATCGAAGAGGTAATGAGTACTATAAAGCTTGAGAAAAGATGTCGTTTTTCAGAGGATTTCT
TCTACAATTTGATGAGGATTTACGGGAATTTAGCCGGAAGAATCAACCGAGCGATCGAGATTTTGTTCGGTATGCCGGAT
TTCGGATGCTGGCCAAGCGCCAAAAGTTTCAATTTCATTCTGAATTTACTTGTTTCGGCGAAGTTGTTCGATGAGATTCA
TAAGATCTTTGTGAGTGCTCCTAAGCTGGGTGTTGAAATCGATGCTTGTTGTTTGAATATACTCATCAAAGGACTGTGCG
AGAGTGGGAATTTGGAAGCTGCACTCCAACTGCTCGACGAATTTCCTAAACAAAAATCACGGCCTAATGTGATGACGTTT
TCACCTTTGATCCGTGGTTTCTGTAATAAGGGAAAGTTCGAAGAAGCTTTTAAGTTGTTGGAGAGGATGGAGAAGGAACG
AATCGAACCAGACACTATCACGTTTAACATTTTGATTTCAGGGCTTAGGAAGAAAGGTAGGGTTGAAGAAGGGATTGATC
TTTTGGAGAGAATGAAGCTAAAGGGGTGTGAACCAAATCCTGGGACTTATCAGGAGGTGTTATATGGTCTCTTGGATAAG
AAGAGGAACTTGGAAGCTAAAGAGATGATGAGTCAGATGATTTCATGGGGTATGAGACCCAGTTTTCTGTCGTACAAGAA
GATGGTTCTGGGGCTCTGCGAAACGAAGTCGGTTGCAGAAATGGACTGGGTTTTGAGGAAAATGGTGAATCATGGTTTTG
TTCCAAAAACAGGCATGTGGTGGAAAGCCGTTTGCTGTGTTGTTTCAAAGAACAATGACTCTCAAGCAAATTTGGATCGC
ATTACTGCTGGCAAGGAAACTCCTGGATAA