Details for Lyrate rockcress Locus 16065297

Position : sca1 ( 5`- 7701600 .. 7699485 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_472054 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065297

Protein [Map View]
MPSVVSKQYSDDVSLLVLLLDTNPLFWSTTSITFSQFLSHVLAFLNAVLGLNQLNQVVVIATGYSSCDYIYDSSLTSNHG
NLESNGTGMPALFGSLLKKLEDFVTKDEELSREEVSEDRIPSCLLSGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDG
PEQYVAVMNSIFSAQRLMVPIDSCYIGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRSFVQLPKPIGV
DFRASCFCHKKTIDMGYICSVCLSIFCEHHKKCSTCGSVFGQSKLDDASSVSDKKRKAPST*

DNA
ATGCCTTCCGTTGTTTCTAAGCAGTATTCAGACGATGTTAGTCTTCTAGTTTTGTTGCTTGATACGAATCCTCTTTTCTG
GAGCACTACATCGATTACCTTCTCTCAATTCCTTTCTCATGTGCTTGCGTTTCTGAATGCAGTTTTGGGCTTAAATCAGT
TGAACCAAGTTGTAGTTATAGCTACTGGATACAGTTCCTGTGATTACATTTATGATTCTTCTTTGACATCCAATCATGGA
AATCTCGAGAGCAACGGAACTGGAATGCCTGCACTTTTTGGTTCTTTGCTGAAGAAATTGGAAGATTTTGTTACAAAAGA
TGAGGAGCTCAGCAGGGAGGAAGTGTCTGAGGATAGAATACCTTCTTGTCTCTTGTCAGGATCACTCTCCATGGCTCTTT
GCTATATACAGAGGGTTTTCCGTTCTGGACATCTTCATCCCCAGCCTCGGATATTATGCTTGCAAGGTTCCCCAGATGGC
CCGGAACAATATGTTGCTGTTATGAACTCTATCTTCTCTGCCCAACGCTTAATGGTACCCATTGATTCGTGTTACATAGG
AGTTCAGAACTCAGCATTTTTGCAGCAGGCATCTTATATAACTGGTGGTGTACATCATACACCTAAACAGTTGGATGGGC
TGTTTCAGTATCTAACGACGATTTTTGCAACTGACTTGCATTCCCGCAGTTTTGTACAACTTCCTAAACCCATTGGTGTT
GATTTTCGCGCATCGTGCTTTTGCCACAAGAAGACAATAGATATGGGCTACATATGTTCAGTGTGTCTGTCCATTTTCTG
TGAGCATCACAAGAAATGTTCAACGTGCGGATCTGTTTTTGGTCAGTCTAAACTTGATGATGCTTCATCTGTCTCTGATA
AGAAGAGAAAAGCTCCTAGTACCTAA