Details for Lyrate rockcress Locus 16065281

Position : sca1 ( 5`- 7671871 .. 7661563 -3` )
Annotation : [B2G] ketose-bisphosphate aldolase class-ii family protein
External links : CoGe
PGDD synteny : 16065281

Protein [Map View]
MGGVVGFVGLDSYSFELASSLLRSGFKVQAFEISTELVEKFTELGGHKCDSPADVGKGAAAVVVLLSHPDQVQDVIFGDE
GVMKGLQKDTVLLLSSTISTLQLQKLEKQLTENREQIFVVDAYVLKGMSELLDGKLMIIASGRSDSITRAQPFLTAMCQK
LYTFDGEIGAGSKVKMVNELLEGIHLVAAVEAISLGSQAGVHPWILYDIISNAAGNSWIYKNHIPLLLKDDIEGRFLNVL
AQNLGIVEDKAKSLPFPVPLLAVARQQLISGISQMQGDDTATSLAKIWEKVLGVGILEAANRELYKPEDLAKEITSQAKP
VNRVGFIGLGAMGFGMAAHLLKSNFSVRGYDVYKPTLVRFENAGGLVANSPAEVTKDVDVLVIMVTNEVQAEDVLYGHLG
AVEAIPSGATVVLASTVSPAFVSQLERRLENEGKDLKLVDAPVSGGVKRAAMGELTIMASGTDEALKSAGLVLSALSEKL
YVIQGGCGAGSGVKMVNQLLAGVHIASAAEAMAFGARLGLNTRKLFNVISNSGGTSWMFENRVPHMLDNDYTPYSALDIF
VKDLGIVTREGSSRKVPLHISTVAHQLFLAGSAAGWGRIDDAGVVKVYETLAGIKVEGRLPVLKKQDLLNSLPSEWPLDP
TADIHRLNMGNSKTLVVLDDDPTGTQTVHDVEVLTEWSVESISEQFRKKPACFFILTNSRSLSPEKASALIKDICSNLCA
ASKEVGNADYTIVLRGDSTLRGHFPQASLEADAAVSILGEMDAWIICPFFLQGGRYTINDVHYVADSDRLVPAGETEFAK
DASFGYKSSNLREWVEEKTAGIIPANSVQSIPIQLLRKGGPDAVCEFLCSLKKGSTCIVNAASERDMAVFAAGMIQAELK
GRSFLCRTAASFVSALIGIIPKDPVLPKDFASNKESSGALIVVGSYVPKTTKQVEELQSQHKQKLRSIEISVEKVALKSS
EVREEEIRRAVEMADAFLRAGRETLIMSSRELITGKTSSESLDINSKVSSALVEVVSQISTRPRYILAKGGITSSDTATK
ALKARRALVIGQALAGVPVWKLGPESRHPGVPYIVFPGNVGNSTALAEVVKSWSVVAGRSTKELLLNAEKGGYAVGAFNV
YNLEGVEAVVAAAEEENSPAILQVHPGAFKQGGIPLVSCCISAAEQARVPISVHFDHGTTKHELLEALELGLDSVMVDGS
HLSFTENLSYTKSITELARSKNIMVEAELGRLSGTEDGLTVEDYEAKLTNVHQAEEFMETGIDALAVCIGNVHGKYPESG
PKLKLDLLKELHALSSKKGVILVLHGASGLSEKLIKECIENGVRKFNVNTEVRTAYMEALSSGKKTDLVDVMSATKAAMK
AVITDKIRLFGSAGKA*

DNA
ATGGGTGGCGTCGTTGGGTTTGTTGGTCTTGATTCTTACAGCTTCGAATTAGCTTCTTCGCTTCTTCGTTCTGGGTTTAA
GGTTCAAGCATTCGAGATAAGTACAGAATTAGTGGAGAAGTTCACTGAATTGGGAGGACACAAATGTGACAGCCCTGCTG
ATGTTGGGAAAGGTGCAGCAGCCGTGGTGGTTTTACTATCCCACCCTGACCAAGTTCAAGATGTCATTTTTGGTGATGAG
GGTGTTATGAAAGGTCTACAGAAGGACACTGTATTGCTTTTGTCTTCGACAATATCGACTTTGCAACTCCAGAAGCTAGA
GAAACAACTTACAGAGAACAGAGAGCAGATTTTTGTAGTTGATGCCTATGTTTTAAAAGGGATGTCTGAGCTTCTTGATG
GAAAACTAATGATAATAGCATCTGGAAGGTCAGATTCGATCACAAGAGCACAACCCTTTCTTACTGCAATGTGTCAGAAG
CTGTACACTTTTGATGGAGAAATTGGTGCTGGAAGTAAAGTTAAAATGGTGAATGAGCTGCTTGAGGGCATTCATCTTGT
TGCTGCTGTGGAGGCTATATCTTTAGGTTCTCAGGCGGGTGTGCATCCGTGGATACTGTATGACATAATTTCCAATGCTG
CTGGAAATTCATGGATTTACAAGAATCATATTCCTTTGTTGCTAAAAGATGATATAGAGGGTCGCTTCCTCAATGTTCTC
GCTCAAAATTTGGGCATTGTTGAAGATAAAGCCAAATCGCTCCCATTTCCTGTCCCACTTTTGGCAGTTGCACGCCAACA
ACTAATCTCCGGAATATCACAGATGCAGGGAGATGATACAGCTACTTCATTGGCTAAGATCTGGGAAAAAGTACTTGGTG
TTGGCATATTAGAAGCAGCCAATAGAGAACTTTATAAGCCAGAGGATTTGGCCAAAGAAATTACTTCTCAAGCAAAGCCT
GTGAATAGAGTTGGTTTTATTGGTCTTGGAGCAATGGGTTTTGGCATGGCAGCACACCTGTTGAAATCAAATTTTTCTGT
CCGCGGTTATGACGTATACAAGCCAACACTTGTCAGATTTGAGAATGCCGGGGGATTGGTGGCAAATTCTCCAGCTGAAG
TGACGAAAGATGTAGATGTTCTTGTAATTATGGTAACAAACGAGGTTCAGGCTGAGGATGTCTTGTATGGACATCTTGGA
GCGGTTGAAGCTATTCCATCTGGAGCGACTGTTGTACTTGCGTCAACAGTCTCTCCCGCGTTTGTTAGCCAACTTGAAAG
GCGTCTAGAAAATGAGGGAAAGGACCTAAAGCTGGTGGATGCTCCTGTTTCTGGTGGTGTCAAGAGGGCTGCCATGGGGG
AACTTACGATAATGGCTTCAGGTACCGATGAAGCACTTAAGTCTGCGGGACTTGTGTTATCAGCATTAAGTGAGAAGCTC
TACGTGATTCAAGGAGGTTGTGGGGCAGGAAGTGGTGTAAAAATGGTCAATCAATTGCTTGCGGGAGTTCATATCGCATC
AGCTGCCGAGGCAATGGCATTCGGAGCTCGGTTAGGTCTGAATACTAGAAAGCTATTCAATGTTATTTCCAACAGCGGTG
GAACATCTTGGATGTTTGAAAATCGTGTTCCGCACATGCTCGATAATGATTATACACCATACTCTGCTCTTGATATTTTT
GTCAAGGATTTGGGAATTGTTACTCGAGAAGGTTCATCCCGTAAAGTTCCACTCCATATATCAACAGTGGCACACCAGCT
ATTCTTAGCCGGCTCTGCTGCGGGCTGGGGACGGATTGATGATGCTGGAGTGGTGAAGGTATATGAAACCCTTGCTGGGA
TTAAAGTCGAAGGGAGACTTCCTGTTCTGAAGAAACAAGACCTACTGAATTCTCTTCCATCTGAATGGCCTTTAGACCCT
ACAGCTGACATACATAGACTAAATATGGGAAACTCGAAGACATTGGTTGTTCTTGATGATGATCCAACCGGGACACAAAC
TGTTCATGACGTAGAGGTTTTAACTGAATGGAGTGTTGAATCTATTTCTGAGCAGTTCAGAAAAAAGCCTGCATGCTTCT
TCATTTTGACAAATTCAAGGTCATTAAGCCCTGAGAAGGCTAGTGCGTTGATCAAAGACATCTGTTCCAACCTATGTGCT
GCATCAAAAGAAGTTGGCAACGCTGACTACACTATTGTTCTGAGGGGTGATTCAACATTACGTGGTCATTTTCCTCAGGC
AAGTTTGGAAGCAGATGCTGCTGTCTCAATACTTGGGGAAATGGATGCATGGATTATTTGCCCCTTCTTCCTTCAAGGAG
GACGTTATACTATTAATGATGTGCATTATGTTGCGGATTCTGATAGGCTCGTTCCTGCAGGAGAGACAGAGTTTGCCAAA
GACGCATCCTTTGGATATAAATCCTCAAATCTCCGTGAGTGGGTTGAGGAGAAAACAGCTGGCATCATTCCGGCTAACAG
CGTTCAGTCGATCCCAATTCAGCTTTTAAGAAAAGGTGGTCCTGATGCAGTGTGTGAGTTTCTATGCAGTTTAAAGAAGG
GGTCTACATGTATTGTCAACGCCGCTAGTGAAAGAGACATGGCTGTATTTGCAGCGGGGATGATCCAGGCAGAACTGAAA
GGGAGATCCTTTTTATGCCGCACTGCTGCTAGCTTTGTGTCTGCTCTAATAGGGATTATTCCAAAAGATCCTGTGTTGCC
GAAAGATTTCGCATCTAACAAAGAAAGTAGTGGTGCACTAATAGTTGTAGGCTCATATGTCCCGAAAACAACAAAGCAGG
TTGAAGAACTACAATCACAACATAAGCAGAAGTTAAGGAGCATCGAGATCTCTGTAGAAAAAGTTGCTCTCAAGTCATCC
GAAGTGAGAGAGGAAGAAATCAGAAGAGCAGTTGAGATGGCTGATGCTTTCCTTCGGGCTGGCAGGGAGACTCTGATTAT
GAGCAGTCGTGAACTCATCACGGGGAAAACATCTTCCGAAAGTCTTGATATTAACAGCAAAGTGAGCTCCGCTCTGGTTG
AAGTAGTGAGCCAGATATCAACCAGACCTCGTTATATTCTTGCTAAGGGTGGAATTACGTCATCAGACACAGCAACAAAA
GCACTTAAAGCAAGACGTGCACTTGTGATTGGTCAAGCCCTTGCTGGTGTTCCAGTATGGAAGTTAGGTCCAGAAAGTAG
ACATCCAGGGGTCCCCTACATTGTTTTCCCTGGTAATGTTGGTAACAGCACAGCGCTTGCAGAAGTTGTGAAGTCTTGGT
CAGTGGTAGCAGGACGGTCGACAAAAGAGCTGCTTCTTAATGCAGAAAAAGGTGGATATGCAGTTGGAGCATTTAATGTG
TATAACCTGGAAGGAGTAGAAGCTGTTGTAGCAGCTGCAGAGGAAGAAAACAGTCCTGCCATATTGCAGGTCCATCCAGG
TGCCTTCAAGCAAGGAGGCATTCCATTGGTTTCATGTTGCATCTCTGCAGCTGAACAAGCTAGGGTTCCAATATCCGTAC
ACTTTGACCATGGAACTACAAAGCATGAGCTATTAGAAGCTCTTGAGCTAGGATTAGATTCAGTGATGGTAGATGGTTCT
CATCTTTCCTTCACAGAAAATTTATCCTACACGAAATCCATAACAGAGTTGGCCCGTTCCAAAAACATTATGGTGGAAGC
TGAACTAGGTCGACTCTCAGGAACAGAGGATGGCTTGACTGTTGAAGACTATGAAGCAAAGCTCACCAACGTTCACCAGG
CTGAGGAATTTATGGAAACTGGTATAGATGCTTTGGCTGTGTGTATAGGAAATGTCCATGGAAAATACCCCGAGTCCGGT
CCAAAACTCAAGCTTGACTTACTTAAGGAACTCCACGCCTTAAGCTCAAAGAAAGGCGTCATTCTTGTTCTTCATGGAGC
TTCTGGTTTGTCTGAGAAGCTTATCAAGGAATGCATTGAAAATGGAGTGAGGAAGTTCAACGTGAACACAGAAGTAAGAA
CGGCTTACATGGAAGCTCTTAGCTCTGGGAAGAAGACCGACCTTGTTGATGTCATGTCGGCAACAAAAGCAGCCATGAAA
GCTGTGATCACCGATAAGATCCGTCTCTTTGGCTCTGCTGGAAAAGCTTGA