Details for Lyrate rockcress Locus 16065266

Position : sca3 ( 5`- 9881815 .. 9881408 -3` )
Annotation : [B2G] 60s ribosomal protein l27
External links : CoGe
PGDD synteny : 16065266

Protein [Map View]
MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGTSDRRYGHCLVAGLKKYPSKVIRKDSAKKTAKKSRVKCFIKLVNYQHL
MPTRYTLDVDLKEVATLDALKSKDKKVTALKEAKAKLEERFKTGKNRWFFTKLRF*

DNA
ATGGTGAAGTTTCTGAAGCAGAACAAGGCCGTGATCCTCCTTCAAGGCCGTTACGCCGGTAAGAAGGCAGTGATCATCAA
ATCCTTCGACGACGGAACCAGTGACCGTCGTTACGGACACTGCCTCGTCGCCGGACTGAAGAAGTATCCAAGCAAAGTCA
TCCGCAAAGACTCAGCGAAGAAGACGGCGAAGAAGTCTCGAGTGAAATGTTTCATCAAACTCGTGAATTACCAGCATCTG
ATGCCTACACGTTACACACTCGATGTAGATCTGAAGGAAGTTGCGACTCTTGATGCTCTTAAGAGTAAAGATAAGAAGGT
GACTGCTCTTAAGGAAGCTAAGGCTAAGCTTGAGGAGAGGTTCAAGACTGGCAAGAACAGGTGGTTCTTTACTAAGCTCA
GGTTCTGA