Details for Lyrate rockcress Locus 16065239

Position : sca3 ( 5`- 13061393 .. 13059643 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065239

Protein [Map View]
MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYA
HELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVVATGEDFSIEPTESRRPFRALLDVGLIRTTTGNRVFG
ALKVLKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEE
LYKKVHAAIRADPNPKKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGGDDDDEDDEE*

DNA
ATGGTGTTTGTGAAGTCCTCCAAGTCGAATGCTTACTTCAAGAGGTACCAAGTTAAGTTCAGGAGAAGAAGAGATGGGAA
GACTGATTACAGGGCAAGGATCCGTCTTATCAATCAGGATAAGAACAAGTACAATACACCTAAGTACCGTTTTGTTGTCC
GGTTTACCAACAAAGACATAGTGGCACAGATTGTCTCTGCAAGCATTGCTGGTGACATTGTTAAAGCTTCTGCTTACGCA
CATGAGTTGCCTCAGTATGGTCTCACTGTTGGTCTTACAAACTATGCTGCAGCTTACTGTACTGGCCTCCTTTTGGCTCG
CCGTGTTCTGAAGATGTTGGAAATGGATGACGAGTATGAGGGCAATGTTGTGGCCACTGGAGAGGACTTTTCCATTGAGC
CAACTGAGTCGAGGAGACCTTTCCGTGCTCTTCTTGATGTCGGACTTATCAGGACCACAACAGGAAACCGTGTGTTTGGT
GCCCTCAAGGTACTTAAGGGTGCTTTGGATGGAGGTCTTGATATCCCTCACAGTGACAAGAGATTTGCTGGATTCAACAA
GGAGAACAAACAACTTGATGCTGAAATCCACAGGAACTACATCTATGGTGGCCATGTTTCAAACTACATGAAGCTGTTGG
GAGAAGATGAGCCAGAGAAGCTACAAACTCACTTCAGTGCATACATCAAGAAAGGAGTTGAAGCTGAGAGCATCGAAGAG
TTGTACAAGAAGGTTCACGCGGCTATTCGCGCAGACCCCAACCCAAAGAAAACCGAGAAACCTGCCCCCAAGCAACACAA
GAGGTACAACTTGAAGAAACTGACGTACGAGGAGAGGAAGAACAAGTTGATCGAGAGAGTCAAGGCATTGAATGGAGCAG
GTGGTGATGATGATGATGAGGACGATGAAGAGTAA