Details for Lyrate rockcress Locus 16065232

Position : sca3 ( 5`- 6390988 .. 6390331 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065232

Protein [Map View]
MEISTNPPSSSSSSASSSIINGSLHHHHIITRSDHYPTTFVQADTSSFKQVVQMLTGSSSPRSPDSPRPPTTPSGKGNFV
IPPIKTAQPKKHSGNKLYERRSHGGFNNNLKNSLMINTLMIGGGGGAGSPRFSPRNQEILSPSCLDFPKLALNSPVTPLK
QGNNGNDGDPFDKMSPLSEEERAIADKGYYLHQSPISTPRDSEPQLLPLFPVTSPRVSP

DNA
ATGGAGATTTCAACAAACCCACCATCATCTTCTTCATCATCTGCTTCATCTTCCATTATCAATGGATCTTTACATCATCA
TCACATCATAACTAGATCTGATCATTATCCAACAACTTTTGTTCAAGCAGACACTTCTTCTTTCAAACAAGTCGTTCAGA
TGCTCACCGGAAGCTCTTCCCCGAGATCTCCTGACTCGCCGCGTCCTCCGACGACTCCTTCCGGCAAGGGTAATTTCGTG
ATTCCACCGATCAAAACCGCACAACCGAAGAAACATTCTGGCAACAAACTTTACGAGAGAAGATCACACGGCGGATTTAA
CAACAACCTCAAGAACAGTCTCATGATTAACACACTCATGATCGGTGGTGGTGGTGGCGCCGGAAGTCCAAGATTCTCGC
CGAGAAATCAGGAGATTTTGTCGCCTAGCTGTCTTGATTTTCCCAAGCTTGCACTTAACAGTCCCGTGACGCCGTTAAAG
CAGGGAAACAATGGAAACGACGGCGATCCTTTCGACAAGATGTCGCCATTATCGGAGGAAGAGAGAGCTATCGCTGACAA
GGGTTATTACCTGCACCAGTCTCCGATTTCAACTCCGAGAGATTCTGAGCCGCAGCTTCTGCCTCTGTTCCCGGTGACTT
CTCCGAGAGTATCGCCGG