Details for Lyrate rockcress Locus 16065229

Position : sca3 ( 5`- 7208300 .. 7207408 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065229

Protein [Map View]
MSEGSEETKTKVDSAGELSDVDNENCSSSGSGGGSSGDTKRTCVDCGTIRTPLWRGGPAGPKSLCNACGIKSRKKRQAAL
GMRSEEKKKNRKSSGNDLNLDHRNAKNDKINKDDDAKNDKINKDDDAKNDKINKDDDLKTCNSKTVEKKRLWRKLGEEER
AAVLLMALSCSSVYA*

DNA
ATGTCTGAGGGATCAGAAGAAACGAAAACAAAGGTCGACTCTGCCGGAGAGTTATCAGATGTTGATAATGAGAATTGCAG
TAGCAGCGGAAGTGGCGGTGGTAGTTCTGGTGATACCAAGAGAACTTGCGTTGATTGTGGAACTATCCGAACTCCTCTTT
GGCGTGGTGGCCCTGCCGGACCAAAGTCATTGTGCAATGCTTGTGGGATCAAGAGTAGGAAGAAGAGACAAGCTGCTCTT
GGTATGAGATCAGAGGAGAAGAAGAAAAACAGAAAAAGCAGCGGTAATGATCTAAACCTCGATCATCGAAACGCCAAGAA
CGACAAGATCAACAAAGATGATGATGCCAAGAACGACAAGATCAACAAAGATGATGATGCCAAGAACGACAAGATCAACA
AAGATGATGATCTTAAAACTTGCAATAGCAAGACGGTTGAGAAGAAGAGGTTATGGAGGAAACTCGGTGAGGAAGAAAGA
GCTGCTGTGCTTCTTATGGCGCTCTCTTGTAGCTCTGTTTACGCCTAA