Details for Lyrate rockcress Locus 16065223

Position : sca1 ( 5`- 7645053 .. 7644544 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_889234 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065223

Protein [Map View]
MASANPETAKPTPASVDMANPDELKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTDRDGYINLDEF
STLCRSSSSAAEIRDAFDLYDQDKNGLISAAELHQVLNRLGMSCSVEDCTRMIGPVDADGDGNVNFEEFQKMMTSSSLLN
SNGSAAPST*

DNA
ATGGCAAGCGCAAATCCAGAAACCGCCAAACCCACGCCAGCATCGGTGGACATGGCTAATCCAGATGAGCTTAAGAAAGT
TTTCGACCAGTTTGACTCCAACGGTGACGGCAAGATCTCAGTCCTCGAACTCGGCGGTGTGTTTAAGGCTATGGGGACTT
CCTACACGGAGACGGAACTCAACCGCGTTCTGGAAGAAGTCGATACAGATCGCGACGGTTACATCAACCTCGACGAGTTC
TCAACTCTCTGCCGCTCGTCTTCCTCCGCCGCAGAGATCCGTGACGCTTTCGATCTATACGATCAGGACAAAAACGGACT
GATCTCCGCCGCTGAGCTTCACCAGGTTCTTAACCGTCTCGGGATGTCTTGCTCTGTTGAAGATTGTACTCGTATGATCG
GACCTGTGGATGCCGACGGCGATGGGAATGTCAATTTCGAAGAGTTTCAGAAGATGATGACGTCGTCTTCTCTCCTCAAC
AGCAATGGATCCGCCGCTCCTTCGACCTAA