Details for Lyrate rockcress Locus 16065207

Position : sca3 ( 5`- 2699390 .. 2702553 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477956 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065207

Protein [Map View]
MELVALLIKVAGLVATITVGANAFSYSRFRRQNLAKFRSPIDESKEVLADFNSIEHKEGKFFFGLATAPAHVEDDLDDAW
LQFAKETPCSASDAEAADKKAKRKKVKLAVGAITKGLAKNSHGKEDKTAADKPPSKNVAAWHNAPHAEERLKFWSDPDKE
VKLAKDTGVTVFRMGVDWSRIMPVEPTKGIKEAVNYEAVEHYKWILKRVRSNGMKVMLTLFHHSLPPWAADYGGWKMEKT
VDYFMDFTRIVVDSMFDLVDSWVTFNEPHIFTMLTYMCGSWPGNNPDFLEIATSTLPMGVFHRALHWMAVAHSKAYDYIH
GKISLKKPLVGVAHHVSFMRPYGLFDIGAVTISNSLTMFPYIDSICEKLDFIGINYYGQEAVCGAGLKLVETDEYSESGR
GVYPDGLYRVLLMFHERYKHLKVSFIVTENGVSDETDVIRRPYLIEHLLALYAAMLKGVPVLGYIFWTISDNWEWADGYG
PKFGLVAVDRSHNLARTLRPSYHLFSKIVKSGKVTRKDRSLAWNELQKAAKAGKLRPFYRAVDNHNLMYADGLDKPQWRP
FVDRDWRFGHYQVDGLQDPLSRVARTLLIWPLIMKKRIKKVKIKHTDDAGLVLHPALASPFD*

DNA
ATGGAATTAGTCGCATTGCTAATTAAGGTCGCCGGTCTTGTGGCCACTATCACCGTTGGAGCCAACGCATTTTCCTACTC
TCGGTTCCGTCGCCAGAATCTCGCGAAGTTTCGCTCTCCAATCGACGAATCCAAAGAAGTTCTCGCCGATTTCAATTCCA
TTGAACACAAGGAAGGCAAATTCTTCTTTGGGTTGGCTACTGCACCTGCTCATGTGGAGGATGATTTGGATGATGCTTGG
CTCCAGTTTGCAAAAGAAACTCCATGTTCAGCATCAGATGCAGAGGCTGCTGATAAGAAAGCTAAGAGGAAGAAGGTTAA
GCTTGCTGTGGGAGCTATAACCAAAGGCTTGGCCAAGAACTCACATGGAAAAGAAGATAAGACTGCAGCTGATAAGCCAC
CCTCTAAAAATGTCGCTGCGTGGCATAACGCTCCTCACGCGGAGGAGAGGCTTAAATTTTGGTCAGATCCTGACAAAGAA
GTGAAGCTAGCCAAAGACACTGGCGTTACTGTCTTTAGGATGGGAGTCGATTGGTCTAGGATCATGCCAGTAGAGCCTAC
CAAAGGAATTAAGGAAGCAGTTAACTATGAGGCTGTCGAACACTATAAATGGATACTTAAAAGAGTTCGTTCAAATGGAA
TGAAGGTGATGCTAACGCTGTTTCATCATTCATTGCCACCATGGGCAGCTGATTATGGTGGCTGGAAAATGGAGAAGACA
GTCGACTACTTTATGGACTTTACCAGGATTGTTGTGGATTCCATGTTTGATTTGGTAGACTCTTGGGTAACATTTAATGA
ACCCCATATCTTCACCATGCTTACCTACATGTGTGGGTCTTGGCCCGGTAACAACCCTGATTTTCTGGAGATAGCTACAT
CTACTCTACCAATGGGTGTATTCCATCGAGCCTTACACTGGATGGCTGTTGCTCACTCAAAGGCCTATGACTACATCCAT
GGGAAAATTTCCTTGAAAAAACCTTTGGTAGGTGTTGCGCACCACGTCTCTTTTATGCGGCCATATGGGCTCTTTGATAT
CGGGGCCGTTACTATTAGTAATTCCCTCACTATGTTTCCATATATCGATAGCATTTGTGAGAAGTTGGATTTCATAGGCA
TCAACTACTACGGACAGGAAGCAGTGTGTGGTGCTGGACTAAAGCTTGTAGAGACTGATGAATACAGTGAATCTGGAAGA
GGGGTGTATCCTGACGGACTCTACCGCGTGTTGTTGATGTTCCACGAGAGATACAAACACCTGAAAGTTTCATTCATCGT
CACAGAAAATGGCGTGTCTGATGAAACAGATGTGATTCGACGACCTTACCTGATCGAGCATCTCCTTGCCCTATATGCTG
CAATGCTAAAGGGTGTTCCTGTGCTCGGTTACATATTCTGGACTATATCCGACAACTGGGAATGGGCTGATGGATATGGT
CCAAAATTTGGACTTGTTGCGGTTGACCGATCCCATAATCTTGCCCGAACCCTTCGGCCATCGTACCATCTCTTTTCCAA
GATAGTTAAAAGTGGAAAAGTCACTCGTAAAGATCGGTCTCTTGCATGGAACGAACTCCAAAAAGCTGCCAAAGCAGGAA
AACTACGGCCATTCTACCGAGCCGTTGATAATCATAATCTTATGTACGCAGATGGTCTCGACAAGCCTCAATGGAGACCG
TTTGTCGATCGTGACTGGCGGTTTGGTCATTACCAAGTGGATGGTCTTCAAGACCCATTGAGTCGCGTGGCTCGAACCCT
TCTCATATGGCCACTAATCATGAAAAAGAGGATAAAAAAAGTTAAGATAAAGCACACCGATGATGCTGGGCTCGTTCTAC
ATCCCGCTTTAGCCTCACCCTTTGACTAG