Details for Lyrate rockcress Locus 16065202

Position : sca3 ( 5`- 619503 .. 621506 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065202

Protein [Map View]
MRYQWRRLLLFRSYRSSSHPFLSHHSQFQVISNSTRSFSSFLPERFEVGALQQRQCLLALRSPLTSSVSRSFSSDPAIEE
KPPAETVVIDIFSRLSAKDDIRKELDSNDVVISHELALRVLRELESSPDVAGSFFKWVLEAYPRKLSSKSYNTMLRILGV
NGLVDEFWELVDAMKKKGHGVSANVRNKVGDKFQKDGLESDLERLKEIFASGSMDNSVDKVCNRVCKIVMKEVWSADVEK
QLRDLKLEFKTDLVKMVLEKLDVDPRKALLFFRWIDESGSFKHDEKTYNAMARVLGKEKFLDRFQHIIEEIRSAGYEMEM
ETYVRVSARFCQTKMIKEAVELFEFAMAGSNTPTPHCCSLLLKKIVSAKKLDMDLFTRTVKAYTGNGNVVPDSMLQHVLK
SLRSVDRFGQSNEVLKAMNEGGYVPSGDLQSVIASGLSRKGKKDEANELVNFMEASGNHLDDKAMASLVEGHCDAKDLEE
ASECFNKMIGKEGVSYAGYAFEKLVLAYCNSFQARDVYKLFTELVKQNQLKPWHSTYKIMVRNLLMKKVARDGGFEEALS
LLPMMKNHGFPPFVDPFMDYLSNSGTSAEAFAFLKAVTSKKFPSNSMVLRVFEAMLKSARHSEAQDLLSMSPSYIRRNAE
VLELFNSMKPDKCSLEKPLPAPAQIEA*

DNA
ATGAGGTATCAATGGAGGAGGTTGCTACTTTTTCGGAGTTATCGTTCGTCTAGTCATCCATTTCTTTCTCATCACTCCCA
GTTCCAGGTAATCTCCAATTCGACTCGATCTTTCTCTTCTTTCCTCCCTGAACGTTTTGAAGTTGGAGCTTTGCAACAAA
GACAGTGCCTTCTTGCCTTGCGATCGCCGTTGACGAGCTCTGTTAGCCGAAGCTTTTCTTCTGATCCTGCGATTGAAGAG
AAACCTCCTGCTGAGACGGTTGTGATTGATATTTTTAGCAGATTGAGTGCTAAGGATGATATTAGGAAAGAGCTGGATTC
GAATGATGTTGTGATTAGCCATGAATTAGCATTGAGAGTTCTGAGGGAACTTGAATCAAGCCCTGATGTTGCGGGAAGTT
TTTTCAAGTGGGTTTTGGAGGCGTATCCTCGAAAACTCTCCTCCAAGAGTTATAACACGATGCTGCGTATTCTTGGTGTT
AATGGACTTGTTGATGAATTTTGGGAATTGGTTGATGCTATGAAGAAGAAAGGGCATGGTGTTTCAGCTAATGTTAGGAA
CAAAGTGGGTGACAAGTTTCAGAAAGATGGACTGGAAAGTGATTTGGAGAGGCTTAAAGAGATTTTTGCTTCAGGTTCTA
TGGATAATTCGGTGGATAAGGTTTGCAATAGGGTGTGTAAGATTGTGATGAAGGAAGTGTGGAGTGCTGATGTGGAGAAA
CAGCTAAGGGATTTGAAGCTCGAGTTTAAAACTGATCTGGTGAAGATGGTGTTGGAAAAACTTGACGTGGATCCGAGGAA
AGCTTTGTTGTTCTTTAGGTGGATTGATGAGTCTGGCAGTTTTAAGCATGATGAGAAGACGTATAATGCTATGGCCAGGG
TCTTAGGGAAAGAGAAGTTTCTTGATAGGTTTCAGCACATTATAGAGGAAATTAGGAGTGCTGGTTACGAGATGGAAATG
GAGACTTATGTTAGGGTTTCGGCGAGGTTCTGTCAGACTAAAATGATTAAAGAAGCTGTCGAATTGTTCGAGTTTGCAAT
GGCGGGTAGCAACACACCCACCCCACACTGCTGCAGTTTACTGCTCAAGAAAATTGTCAGTGCAAAGAAATTGGACATGG
ACTTGTTTACAAGAACTGTGAAAGCTTATACTGGTAATGGCAACGTTGTGCCGGATTCTATGCTGCAACATGTCCTCAAG
TCTTTGAGAAGCGTTGATAGGTTTGGACAGAGCAATGAGGTGTTGAAAGCGATGAACGAAGGCGGCTATGTTCCTAGCGG
TGATTTGCAGAGTGTGATTGCATCAGGACTTAGTCGTAAGGGCAAGAAAGATGAAGCAAACGAACTTGTGAACTTTATGG
AAGCCTCTGGAAATCATTTAGATGACAAAGCAATGGCATCTTTAGTTGAAGGGCACTGTGATGCTAAAGATCTCGAAGAA
GCTTCAGAGTGTTTCAATAAGATGATTGGGAAAGAGGGAGTCTCTTATGCAGGTTATGCATTTGAGAAGTTGGTACTTGC
TTATTGCAACAGTTTTCAGGCAAGAGATGTATACAAGCTTTTCACCGAGCTAGTGAAACAAAATCAGTTGAAACCTTGGC
ACAGTACATACAAAATCATGGTCAGGAATCTATTGATGAAGAAGGTAGCAAGAGATGGTGGGTTTGAAGAAGCTTTGAGT
CTTCTACCTATGATGAAAAATCACGGGTTCCCTCCTTTCGTGGACCCGTTCATGGATTATTTATCGAATAGTGGAACAAG
CGCAGAGGCTTTCGCTTTTCTGAAGGCCGTGACTTCAAAGAAGTTTCCATCTAATTCAATGGTTCTGCGTGTATTTGAAG
CTATGTTGAAGTCTGCAAGGCATAGTGAAGCTCAGGATTTGCTGTCTATGTCCCCAAGTTATATCCGTCGCAATGCAGAA
GTTCTAGAACTTTTCAATTCCATGAAACCTGATAAATGTTCCTTAGAGAAACCTTTGCCTGCTCCTGCTCAAATCGAAGC
CTAA