Details for Lyrate rockcress Locus 16065189

Position : sca3 ( 5`- 1414803 .. 1414363 -3` )
Annotation : [B2G] 40s ribosomal protein s16
External links : CoGe
PGDD synteny : 16065189

Protein [Map View]
MASQPAKESVQCFGRKKTAVAVTHCKRGSGMIKLNGSPIELHQPEILRFKILEPILLLGKHRFAGVDMRIRVEGGGNTSQ
VYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCESKKFGGKGARSRFQKSYR*

DNA
ATGGCGAGCCAACCGGCGAAAGAGTCTGTTCAATGCTTCGGAAGGAAGAAGACGGCCGTTGCCGTCACCCACTGCAAACG
CGGCTCGGGTATGATTAAGCTCAACGGTTCGCCGATCGAGCTTCATCAGCCAGAGATCCTCCGATTCAAGATCTTGGAGC
CAATCCTTCTCCTCGGGAAGCACCGTTTCGCTGGAGTTGACATGAGGATCCGAGTCGAAGGTGGTGGTAACACATCTCAG
GTCTACGCAATCCGTCAGAGTATCGCTAAGGCTCTCGTTGCTTACTACCAGAAGTACGTTGATGAGCAGTCGAAGAAGGA
GATCAAGGACATCTTGGTGAGGTACGATAGGACTCTACTTGTTGCGGATCCTAGGAGGTGCGAATCGAAGAAGTTTGGTG
GTAAAGGTGCTCGTTCTCGTTTCCAGAAGAGTTACCGTTAA