Details for Lyrate rockcress Locus 16065158

Position : sca3 ( 5`- 6103517 .. 6103981 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065158

Protein [Map View]
MASTQYGFDHQSGVEVINDELIMSFLEEESPVENHSSINKEEEEKLNRVIRSLEVEINMSSPTIEARKMDLQQTITGLED
DFGWLNDFDIGMISLQNDDEMMNWCTELSYMDGVVDSSVLEIEGGDYYSHINYGLSFEEPTLSLWQENNDVVMY*

DNA
ATGGCTTCTACGCAATATGGGTTTGATCATCAAAGCGGCGTGGAGGTTATCAACGACGAGCTTATCATGTCGTTTTTGGA
AGAAGAATCCCCCGTCGAAAATCATAGTAGCATCAACAAAGAGGAAGAAGAGAAACTAAACCGTGTGATTAGATCGCTAG
AAGTGGAGATCAACATGAGTTCTCCGACCATAGAAGCTAGGAAAATGGATCTCCAACAGACGATAACCGGTCTTGAAGAT
GATTTCGGGTGGCTTAACGACTTTGATATTGGTATGATTTCGTTGCAAAATGATGATGAGATGATGAATTGGTGTACGGA
ACTTTCTTACATGGATGGTGTGGTAGATAGTAGTGTTCTTGAGATTGAAGGTGGTGATTATTATTCTCATATTAACTATG
GACTTTCATTTGAGGAACCAACTCTTTCTCTATGGCAAGAGAATAATGATGTAGTTATGTATTAA