Details for Lyrate rockcress Locus 16065156

Position : sca3 ( 5`- 1954025 .. 1952481 -3` )
Annotation : [B2G] mitochondrial substrate carrier family protein
External links : CoGe
PGDD synteny : 16065156

Protein [Map View]
MGVDLESVSEATSGAIGSLLSTTILYPLDTCKSKFQAEVRARGQQKYRYLSDVMWEAISKGQVLSLYQGLGTKNFQSFIS
QFIYFYSYSYFKRVHSERTGSKSIGTKANLLIAAAAGACTSVLIQPLDTASSRMQTSEFGESKGLWKTLTEGTWGDAFDG
LVISLLLTSNPAIQYTVFDQLKQHLLKQKNAKAENGSSPVVLSAFMAFVLGAVSKSVATVLTYPAIRCKVMIQAADESKE
NETKKPRRRTRKTIPGVVYAIWRKEGMLGFFKGLQAQILKTVLSSALLLMIKEKITATTWILILAIRRTLFLTNTKGKLK
SP*

DNA
ATGGGTGTCGATTTGGAATCGGTATCGGAAGCAACCTCCGGAGCCATTGGGTCGCTTCTGAGTACAACGATCTTATATCC
TCTTGATACATGTAAATCAAAGTTCCAAGCCGAGGTTCGAGCTCGAGGTCAGCAAAAATACAGATATCTTTCAGATGTTA
TGTGGGAAGCAATTTCTAAAGGACAAGTCTTGTCACTGTATCAAGGCCTTGGAACTAAGAATTTTCAGTCTTTCATTTCT
CAGTTCATCTACTTTTATAGCTATAGCTATTTCAAGAGAGTTCATAGTGAAAGGACTGGTTCTAAATCAATTGGAACTAA
GGCAAACTTGCTCATTGCTGCTGCTGCTGGGGCTTGTACTTCTGTCTTGATTCAGCCTCTGGATACAGCTTCATCAAGGA
TGCAAACTAGTGAGTTTGGGGAATCAAAAGGGTTGTGGAAGACCTTAACAGAGGGTACATGGGGAGATGCATTTGATGGC
CTAGTGATCTCTCTCTTATTGACATCAAATCCTGCAATTCAGTATACAGTGTTTGATCAGCTGAAACAGCATCTTCTTAA
GCAGAAAAACGCAAAAGCAGAGAATGGTTCTTCTCCGGTAGTGCTCTCTGCCTTTATGGCGTTTGTGTTAGGTGCGGTCT
CCAAAAGTGTTGCCACCGTGCTCACATATCCAGCAATCAGGTGCAAGGTGATGATTCAAGCTGCGGATGAGTCGAAGGAA
AACGAAACTAAGAAGCCCAGAAGAAGAACAAGGAAAACAATTCCAGGGGTTGTCTATGCCATATGGAGAAAAGAAGGGAT
GTTAGGGTTCTTTAAGGGCTTACAGGCTCAGATCTTGAAGACTGTTCTGAGCTCAGCATTGCTGTTGATGATCAAGGAGA
AAATCACCGCAACGACATGGATTCTCATTCTAGCTATCCGTAGAACTCTGTTTCTCACAAACACAAAGGGTAAGTTGAAA
AGTCCTTGA