Details for Lyrate rockcress Locus 16065153

Position : sca3 ( 5`- 6633985 .. 6634964 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065153

Protein [Map View]
MGSSCLACFDKSKATTSVDVDVPLNGSKDVLVEEDWSELRNPSVASEDFWTNTTLDMESNAQGSVSSISTTNLTVDSQGC
GSSSNEPTEFVNHGLLLWNQTRQQWVGDKRSESREKIVREPVINENVTYESLLGSNKRFPRPIPLDEMVQFLVEVWEEEG
LYG*

DNA
ATGGGCAGTAGTTGTTTGGCTTGTTTTGATAAGTCGAAAGCAACAACAAGTGTAGATGTAGATGTGCCTTTGAATGGCTC
AAAAGATGTGTTAGTAGAAGAAGATTGGAGTGAATTGAGGAATCCTAGTGTAGCTTCTGAAGATTTCTGGACTAATACCA
CTTTAGATATGGAAAGCAATGCTCAGGGAAGTGTTTCTTCAATCAGTACAACGAATCTGACTGTTGATTCTCAAGGATGT
GGTTCCAGCTCTAATGAACCTACTGAATTTGTTAACCATGGTCTTCTGCTATGGAATCAAACTCGGCAGCAATGGGTGGG
GGATAAAAGATCTGAGAGCCGCGAAAAAATTGTTCGAGAACCGGTTATAAATGAGAATGTGACTTATGAGAGTCTACTTG
GGAGCAACAAGCGGTTTCCGAGGCCAATACCTCTTGATGAAATGGTGCAGTTTCTTGTTGAAGTTTGGGAAGAAGAGGGT
CTGTACGGCTGA