Details for Lyrate rockcress Locus 16065150

Position : sca3 ( 5`- 8265057 .. 8273128 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065150

Protein [Map View]
MVFPWNIAKSAEEAFSRWAVKRVVKFLLKKKLGKLILGDIDLDQLDIQLRDGSIQLSDLAINVDYFNDKFDAPLLIKEGS
IGALVVKMPWKTNGCQVEVDELELVLAPRLETNASSSNEASTSASTREDSHNIRLERGKHENDMLLNAAKSASIDVHEGV
KTVAKIVKWFLTSFHVKIKNLIIAFDPDFGQKLNEAGPRPTLVLRMTEIECGISEDRVSAADVSPDSFLGTSRLANCVKF
QGAVVELLNMDDDDGDKTCGKKTSNDVTLIMTGEGGGFSGSLNFSIPWKNGSLDIRKVDADISIDPVEVRLQPSTIRWFL
QLWKTFTSFGSDCCPSVSHSDSLTDSPTIPTNAMVTPPATLSVSGGQELEPDTTPNLQFIPDWFPSSFSKKEEDGEVDIG
ASVDQFFECFDAMRSYQSACGSQGMWNWTSSVFTAINAASSLASGSLLLPSEQQHVETSCKLSFAGVSVVLFFQDEDNWK
DVSTRIHYLGAELRDISVSFQVCPHDLRLEGEVNSMEIADYFQAGNVVDTANAESQTCLIKDLQAKVQTSLPPFASSDMH
TDSERLSEIVSDGFLFRSKGFAVKTLLVIAAGGSGFQFIVNFQSSKASHRGSNSFSLSLPPTTFWLNLHSVEMLVNLFND
VSESIPIFSHERNQVASSSKSESLRGSVSIWNARVILWFPFESISERLCNSLGEQFIVVDLSSSPQSDKDRRKEGSPGEM
YFTSATRSICFRVGDASIYLVTSDHKDSETNSYRRQVEFSAYNILHTNNKTRHQLSTIGMFWQDRPTVSPCLVERAKMLA
TQEESIQTDKSGGSGLEFAAVATPKDQEDIYSRTRKEIIMASSFCLYLHLLPLAIRLDSWQYSKLCNLVEEAKIWLSRMA
ANTAEQTGESVVCQTSLVVECDSIDILVRPEPQMGIKIQLQTELPGSWIQFNLRVQKLNLMSVSNLGSISGADFFWLAHG
EGTLWGSVTGLADQGLLLLSCNNSAIKRGNGGGSNALSSRFAGLDFLHLQEPGICYDYLAVSVRGCTISAVGGRLDWIEV
ATSFFTFEDEKKSQEMNSSSSSGSSFILNLVDVGLSYEPHHESTDHLRQASIPWVACLVAASSFSLSKKSLVDSIRNDYR
IRIQDLGLLLSVDFDLSKLNGMYSSEHLHETGYVKVANEALIEATLRTNSENGLLWELECSKSHLLIETCSDTTSGLIRL
ATQLQQLLAPDLEESAVHLQTRWDSIQQANARNDFDISDRLSSSDSSGEMKYLRLESENETGVIGLMDEINEDAFQFDVN
LTGQSDSVECQNNYMSPHGVSHGQAYNWVPATPEKLPSNHSICGSSSRINSESSKIFLDRESLPEIFENYCFSDFRPSSE
VPQDGDSSGRELFPETDLRRGNSGWYDDASLRILEDHVSEATEEDHEEHILDGEFSSFGQTSYPAVAPNGRILLKNIDLK
WRIYSGSDWHDSRKKGENFKHTKGRDTTSCLELELSGVLGYYNSKDHPRDSSSYAFKLELKAVRPDPETPLEENRFFGAN
SLEKPDVSMGDSGGSTLSVSVKGHNIIEEALLPYFQKFDVWPVSVRVDYSPHHVDIAALTGGKYAELVNLVPWKHHLLIT
EEYMQGIELQLKHVHAAGIYGWGNVCETILGEWLEDVSQNQIHQLLKGIPTVRSLSALYAAALKLVSSPVESYRKDRRLV
KGVQRGTIAFLRSISLEAVGLGVHLAAGAHDILLRAEYIFASAPSLPQPQGKTKTNVRHNQPRNAKQGMLKACESIGDGI
GKTASALVRTPLKKYQRGDGAGSAFATVVQGVPTAAIAPASACARAVHSALVGIRNRLVHIKYCGNTAGKICYLQSIKDS
WRLLSLLSVLILNIKRNPWKST*

DNA
ATGGTTTTTCCCTGGAACATTGCTAAATCAGCGGAGGAAGCTTTTTCTAGATGGGCGGTGAAGAGGGTCGTCAAATTCTT
GTTGAAGAAGAAATTGGGTAAACTCATACTTGGTGATATCGACCTTGATCAGCTCGATATTCAGCTTCGTGATGGCTCTA
TTCAGCTCTCCGATCTTGCTATCAACGTTGACTATTTTAATGACAAGTTTGATGCTCCCCTACTCATAAAGGAAGGCTCA
ATTGGAGCTTTGGTAGTTAAAATGCCTTGGAAGACTAATGGTTGTCAAGTTGAGGTTGACGAGCTTGAGCTTGTTCTTGC
ACCACGTTTGGAGACTAATGCATCATCTTCAAATGAAGCCAGCACCTCCGCCTCTACCCGAGAAGATTCACATAATATAC
GTCTTGAAAGAGGAAAGCATGAGAATGACATGTTGTTGAACGCTGCAAAATCTGCGTCTATCGATGTCCATGAAGGCGTT
AAGACGGTTGCCAAGATAGTGAAATGGTTTCTTACAAGTTTTCATGTCAAAATTAAGAATCTGATTATAGCATTTGATCC
CGATTTTGGCCAAAAACTGAATGAAGCTGGTCCTCGGCCAACATTGGTACTTAGAATGACAGAAATAGAGTGTGGAATTT
CAGAGGACCGAGTTTCGGCTGCTGATGTTTCTCCTGATAGTTTCCTTGGTACTAGTCGACTTGCAAACTGTGTGAAGTTT
CAAGGAGCCGTCGTAGAGCTTTTAAATATGGATGATGATGATGGCGACAAAACTTGTGGTAAAAAAACATCAAATGATGT
GACTTTGATCATGACCGGCGAAGGAGGTGGCTTTTCAGGGAGTTTGAATTTTAGTATACCCTGGAAGAATGGTTCTTTAG
ACATTCGCAAGGTGGATGCTGATATTTCTATTGATCCTGTTGAAGTACGACTTCAACCGTCTACAATTAGATGGTTCTTA
CAATTGTGGAAGACTTTCACAAGTTTCGGATCAGACTGTTGCCCATCAGTTTCTCATTCTGATTCATTGACGGATTCACC
TACAATACCTACTAATGCAATGGTAACGCCTCCAGCTACACTATCAGTGTCAGGTGGCCAAGAATTGGAGCCTGATACTA
CACCTAACTTACAGTTTATACCGGATTGGTTTCCGTCTTCTTTCAGCAAGAAAGAAGAGGATGGAGAAGTAGATATTGGG
GCAAGTGTGGACCAGTTTTTTGAATGTTTTGATGCAATGAGGAGTTACCAATCAGCTTGTGGAAGCCAAGGAATGTGGAA
TTGGACATCTTCTGTCTTCACAGCAATCAATGCTGCATCTAGCCTTGCTTCTGGGTCTTTGCTTCTTCCTTCTGAACAAC
AACATGTTGAAACAAGTTGTAAATTATCCTTTGCTGGAGTTTCGGTGGTATTATTTTTCCAAGATGAAGACAATTGGAAG
GATGTTTCCACGCGGATTCACTACTTGGGTGCAGAACTCAGAGATATTTCGGTCTCTTTTCAGGTATGCCCTCATGATCT
GAGGTTAGAAGGAGAAGTGAACAGCATGGAGATCGCCGATTATTTTCAAGCTGGAAATGTTGTTGACACTGCTAATGCTG
AATCTCAGACTTGTTTGATTAAGGATTTACAAGCGAAAGTTCAGACTAGTCTTCCTCCCTTTGCCTCGTCTGATATGCAT
ACTGACTCTGAAAGATTAAGCGAGATAGTTTCTGATGGATTTCTCTTTCGTAGCAAGGGTTTCGCAGTCAAGACATTGTT
GGTTATAGCTGCAGGGGGCAGTGGATTTCAGTTTATTGTCAATTTCCAATCATCCAAAGCCAGCCATAGAGGATCAAACT
CATTCTCGTTGAGTTTACCACCTACCACATTCTGGCTGAACCTTCATTCAGTAGAAATGTTGGTAAATCTTTTCAACGAT
GTATCCGAATCTATCCCCATATTCAGTCATGAAAGGAATCAGGTGGCATCCTCTTCTAAATCAGAAAGTTTGCGAGGTAG
TGTGTCAATCTGGAATGCTCGAGTGATTCTGTGGTTTCCTTTTGAGAGCATTTCAGAAAGGTTATGTAACTCGCTTGGTG
AGCAGTTTATTGTCGTCGACTTATCTTCCTCTCCGCAATCTGACAAGGATAGGCGTAAGGAAGGAAGTCCGGGAGAAATG
TACTTTACATCTGCTACTCGCTCTATATGCTTCCGTGTCGGTGATGCTAGCATCTATTTGGTTACTTCTGACCATAAAGA
TTCCGAAACAAATTCATATCGTAGGCAGGTTGAATTCTCTGCATATAATATCTTACATACCAACAATAAAACGAGGCACC
AACTTTCAACCATTGGTATGTTTTGGCAAGATAGACCTACTGTTAGCCCTTGTTTAGTGGAGAGAGCTAAGATGTTGGCT
ACGCAGGAAGAATCTATTCAGACAGATAAATCTGGGGGGAGTGGCCTTGAGTTTGCTGCTGTTGCTACGCCCAAAGATCA
AGAAGACATCTACTCTCGAACCAGGAAAGAAATAATTATGGCTTCTTCATTCTGCCTTTATCTTCATTTGCTTCCACTTG
CTATCCGTTTAGATAGTTGGCAATACAGCAAATTATGTAATCTCGTAGAAGAGGCAAAAATTTGGCTATCACGTATGGCA
GCCAATACAGCTGAGCAAACAGGGGAATCTGTTGTGTGTCAAACGTCTCTCGTTGTTGAATGTGATTCTATTGACATTTT
GGTTAGGCCAGAACCTCAAATGGGCATAAAAATTCAGCTTCAGACTGAGCTTCCTGGATCATGGATTCAGTTCAACCTGA
GGGTTCAGAAATTAAATCTTATGTCTGTCTCAAATCTTGGCAGTATCTCTGGTGCTGATTTCTTTTGGTTAGCCCATGGG
GAAGGCACCTTATGGGGTTCTGTTACAGGTCTAGCTGATCAGGGACTGCTATTACTCTCATGTAACAATTCTGCAATCAA
ACGTGGTAATGGAGGAGGTTCAAATGCATTGTCGTCAAGGTTCGCTGGCTTAGATTTTCTGCACTTACAGGAACCAGGAA
TTTGTTATGATTATTTAGCAGTATCTGTCAGGGGCTGTACGATCTCGGCTGTGGGAGGACGCCTGGATTGGATAGAAGTG
GCTACTTCTTTTTTCACTTTTGAAGATGAAAAAAAATCTCAAGAGATGAACTCCAGCTCATCTAGCGGCTCCTCTTTTAT
TCTGAATTTGGTTGATGTTGGTCTAAGCTATGAGCCCCACCATGAGAGTACAGATCATTTACGTCAAGCAAGTATTCCAT
GGGTTGCCTGTCTGGTAGCTGCATCTTCTTTTAGCCTTTCAAAGAAAAGTCTGGTTGATTCCATAAGAAATGATTATAGA
ATCAGGATTCAAGATCTTGGGCTTCTTCTGTCCGTGGATTTTGACCTTAGCAAGCTTAATGGAATGTACAGTTCAGAGCA
TCTTCATGAGACTGGCTATGTTAAAGTTGCTAATGAGGCGCTTATTGAAGCAACTCTAAGGACTAACTCTGAAAATGGCC
TTCTTTGGGAGTTAGAGTGTTCCAAATCTCACTTATTAATTGAAACTTGCAGTGACACGACTTCTGGTTTGATTCGCTTG
GCCACCCAGCTCCAACAGTTACTTGCTCCTGATTTGGAGGAATCAGCTGTGCACTTGCAGACTCGATGGGACAGCATTCA
GCAGGCAAATGCTAGGAATGATTTTGATATCAGCGACAGACTCAGTAGCTCCGATTCAAGTGGAGAAATGAAATATTTAA
GATTAGAGTCAGAAAATGAAACTGGGGTCATTGGGTTGATGGACGAAATAAATGAAGATGCATTCCAATTTGATGTCAAT
CTGACAGGTCAGTCTGACTCTGTGGAGTGTCAGAATAACTATATGTCACCTCATGGAGTCTCTCATGGGCAGGCATATAA
TTGGGTACCTGCTACTCCTGAGAAACTACCTTCTAATCACAGTATCTGTGGGTCATCATCTAGAATAAATTCAGAAAGCA
GTAAAATATTCCTAGATAGAGAGAGCCTGCCTGAAATATTTGAAAACTATTGTTTTTCTGACTTCCGTCCATCGTCAGAG
GTACCTCAAGATGGGGATTCATCAGGGAGAGAATTGTTTCCTGAGACTGATCTGAGGAGAGGAAATTCTGGGTGGTATGA
TGACGCGTCCTTAAGAATTTTAGAAGACCATGTGTCAGAAGCAACTGAGGAAGATCATGAGGAACATATTCTGGATGGAG
AATTTTCATCTTTTGGCCAGACGTCTTATCCTGCTGTAGCACCTAATGGACGTATCCTTCTGAAAAACATTGACCTCAAA
TGGAGAATTTACTCTGGCTCTGATTGGCATGATTCTAGAAAGAAAGGTGAAAATTTTAAACATACAAAGGGCCGGGATAC
AACTTCGTGCCTTGAGCTGGAGTTATCTGGGGTCCTTGGATATTATAACTCAAAAGATCACCCAAGAGATTCCTCTTCAT
ATGCTTTCAAGTTGGAATTAAAAGCTGTCAGACCTGACCCTGAGACGCCACTTGAGGAAAACCGCTTCTTTGGAGCTAAC
AGCCTAGAAAAGCCTGATGTTTCCATGGGAGACTCAGGTGGTTCAACGTTGTCGGTTTCTGTTAAAGGACATAATATCAT
AGAAGAAGCGCTTCTTCCATATTTTCAGAAATTTGACGTATGGCCTGTTAGTGTTCGAGTTGATTACAGTCCCCATCATG
TTGATATAGCAGCACTAACAGGAGGGAAATATGCAGAGCTTGTGAACCTTGTACCCTGGAAGCATCATTTGCTCATCACA
GAGGAATATATGCAGGGGATTGAATTACAGCTCAAACATGTGCATGCTGCTGGAATCTATGGCTGGGGAAATGTATGTGA
GACTATACTGGGAGAATGGTTGGAAGATGTATCTCAGAATCAGATTCATCAACTGTTAAAGGGGATCCCAACAGTAAGAT
CACTTTCTGCTCTTTATGCTGCTGCTCTAAAGCTGGTCTCGTCACCTGTTGAAAGTTACAGGAAAGATCGAAGGCTAGTG
AAGGGAGTCCAAAGAGGTACTATAGCGTTTCTCAGAAGCATCTCACTGGAAGCTGTTGGACTTGGTGTTCACTTGGCAGC
CGGGGCTCATGATATTTTATTGAGAGCAGAATATATATTTGCAAGTGCACCATCATTGCCACAACCCCAAGGCAAAACAA
AGACGAATGTTAGACATAATCAGCCTAGAAACGCTAAGCAAGGCATGCTTAAGGCATGTGAGAGCATCGGTGATGGAATA
GGAAAGACAGCTTCTGCATTAGTCCGCACACCTTTGAAGAAGTATCAACGTGGAGACGGAGCTGGATCAGCATTTGCAAC
AGTTGTTCAGGGAGTTCCAACAGCTGCTATAGCACCTGCTTCAGCTTGTGCTAGAGCTGTACATAGTGCTCTAGTTGGCA
TCAGAAATAGGTTAGTTCATATTAAATATTGTGGAAATACGGCTGGAAAAATCTGTTATTTGCAAAGTATTAAAGACTCA
TGGAGATTATTATCTCTACTTTCAGTCTTGATCCTGAACATAAAAAGGAATCCATGGAAAAGTACTTAG