Details for Lyrate rockcress Locus 16065137

Position : sca3 ( 5`- 5733467 .. 5733153 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065137

Protein [Map View]
MENYYKEMEPPSAGNRRDAVKGYSGSFDDSAGDQSQTNDYQLKIKKSKSVPNADRAASRSWSFSDPESRRKRRVAGYKVY
SVEQKMKGSIRKSFKWFKDIIGIS*

DNA
ATGGAGAATTATTACAAAGAAATGGAACCGCCATCTGCTGGGAACCGCCGAGACGCAGTGAAAGGTTACAGCGGGAGCTT
CGACGATTCAGCCGGCGATCAGAGCCAAACGAACGATTACCAGTTAAAGATAAAGAAAAGCAAAAGCGTTCCAAACGCGG
ATCGTGCGGCGTCTAGAAGCTGGAGTTTCAGCGATCCAGAATCGCGGAGGAAGAGAAGAGTCGCTGGCTACAAAGTTTAT
TCCGTTGAACAGAAGATGAAGGGATCCATTCGTAAGAGCTTCAAGTGGTTCAAAGACATTATCGGTATTTCTTGA