Details for Lyrate rockcress Locus 16065102

Position : sca3 ( 5`- 8014922 .. 8012486 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065102

Protein [Map View]
MDTEKGYPRGFRADSLRTETGRISFRSDSMQIDEAAELPQGEIRQENSTYLVLFKNIDSGNLEATKEFLDRNPEALTASL
TSNGDTPIHKAVLSGHIKIVEEIIRRIHDPKQVLKIKNDNGYTALSYAATGGIVRIAECLVNRCPGLVSVRNAKEHIPIV
VASLYGHKHLVEYLYNHTPLSDLDPCDDSDEHKGKNGAMLVTNCIVDGLYGIALDLIQRYPKLAYTRDSDNDTAIIALAQ
TPHAFPSVPHIIRRVYKLKLGHAQAKEILDCICQEIPKFDAAQQKNAGLNQALFKAVENGIVEYIEEMMRHYPDIVWFKD
SCGLNIFFYAVSQRQEKIFSLIYNMGAKKNILATNWDKFHNNMLHHAAYRAPASRLNLIPGAALQMQRELQWFKEVERLV
QPKHRKMVNLKQKKTPKALFTDQHKDLVEQGEKWMKETAASCTVVAALITTMMFSSAFTVPGGYRSDGMPLYIHKHMFKI
FLISDAISLFTSCMSLLMFLGILKSRYREEDFLRSLPTKLIVGLFSLFLSMATMMVTFVVTLMTLVGEKISWVSAQFMFL
AVIPLGMFVVLQFPVLLEIFCSTYFPRVFDKPPQSRRMFKLFSRF*

DNA
ATGGATACCGAAAAAGGTTATCCAAGAGGTTTCAGAGCAGACAGTCTACGAACAGAAACAGGCCGCATAAGTTTTCGATC
AGATAGTATGCAGATCGATGAAGCAGCCGAGCTACCACAAGGCGAGATACGACAAGAGAACTCGACCTATCTTGTCCTTT
TCAAGAACATAGACAGTGGAAACTTGGAAGCGACGAAAGAGTTCTTGGACCGAAACCCTGAGGCTTTAACCGCAAGCTTA
ACCTCTAACGGAGACACACCAATCCATAAAGCTGTTCTGTCGGGTCACATCAAGATCGTGGAAGAGATCATTAGAAGAAT
TCATGATCCAAAGCAAGTGTTAAAGATCAAGAACGATAATGGTTACACAGCGCTTAGTTATGCTGCCACTGGTGGGATTG
TGAGAATTGCAGAGTGTTTGGTGAATAGATGTCCCGGTTTGGTTAGTGTTCGGAATGCGAAAGAGCATATACCAATCGTG
GTGGCTTCGTTGTACGGTCACAAACATCTGGTTGAGTATCTTTACAATCACACACCTCTCAGTGATCTTGATCCTTGTGA
TGATTCAGATGAACACAAGGGTAAGAATGGAGCGATGCTCGTGACAAATTGTATTGTAGATGGATTATATGGTATTGCTT
TGGATCTGATTCAGAGGTATCCTAAGTTGGCTTATACTCGAGACAGTGATAACGATACAGCGATTATCGCGCTTGCTCAA
ACGCCTCATGCGTTCCCCAGTGTTCCACACATAATTAGACGTGTATACAAACTGAAGCTAGGACATGCTCAAGCCAAAGA
AATACTAGACTGTATCTGCCAAGAGATACCAAAATTTGACGCGGCCCAACAGAAGAACGCTGGCCTAAACCAAGCTCTCT
TTAAGGCGGTAGAGAATGGTATCGTAGAGTATATCGAGGAAATGATGAGGCATTATCCTGATATCGTATGGTTCAAAGAT
AGTTGTGGTCTTAACATCTTCTTCTACGCGGTAAGCCAGAGACAAGAGAAGATCTTTAGCCTCATTTACAATATGGGTGC
TAAGAAGAACATCCTCGCTACAAATTGGGACAAATTCCATAACAATATGCTTCATCATGCCGCTTATCGAGCCCCAGCCT
CACGGCTTAATCTCATTCCTGGTGCAGCTCTTCAGATGCAAAGGGAACTACAATGGTTCAAGGAAGTGGAGAGGTTAGTG
CAACCGAAGCATCGGAAAATGGTTAACTTGAAGCAGAAGAAAACTCCAAAGGCTCTGTTTACAGACCAACACAAGGACCT
CGTGGAGCAAGGAGAGAAATGGATGAAAGAAACAGCAGCTTCTTGCACAGTCGTAGCCGCTCTAATCACCACAATGATGT
TTTCCTCGGCGTTTACTGTCCCCGGAGGTTACCGTTCAGATGGCATGCCACTCTACATCCACAAGCACATGTTTAAGATT
TTCCTCATCTCCGACGCTATCTCTCTTTTCACATCATGTATGTCTCTCCTCATGTTCCTCGGCATTCTCAAGTCTCGCTA
CCGTGAAGAGGATTTTCTTCGATCACTTCCGACAAAACTGATCGTGGGTCTTTTTTCTTTGTTTCTGTCGATGGCGACGA
TGATGGTGACTTTTGTCGTGACGCTCATGACTTTGGTTGGAGAGAAAATCTCGTGGGTTTCGGCTCAATTTATGTTTCTT
GCGGTGATTCCGCTGGGGATGTTCGTTGTTCTTCAGTTTCCGGTTTTACTTGAGATCTTCTGCTCGACTTATTTCCCTAG
AGTTTTTGATAAGCCTCCCCAGTCTCGGCGAATGTTTAAACTTTTCTCGAGATTTTAA