Details for Lyrate rockcress Locus 16065077

Position : sca3 ( 5`- 479487 .. 480629 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065077

Protein [Map View]
MNNGGGDGGSQQRELPGKRKLFRGSDFAFSIARMAVAQICESVEVNSYQESQTREAVRFSSFHESALEALTDVAVQYIQS
IGKTAHLYANIAGRVDGNSLDIVQALEDLGSGLGFAGFSDADHCLADSGVLKDIIHYTGEAEEMPFVYSLPRFPFSKEKK
PAPSFSEVGPEPPDEHIPIWLPAFPKTKLCDRSEETNAATIEGEIPRKENGSSLPSMQHSFDGGRLDIHTSPKDVRESPK
AVVEGNPFLTAPLRIVEKNVSPVVRPLEISNEVVRTNHVADKHMSNNHHIPVLEASASSDKINNMNWLAESEDGEKEDVA
RKQRTLVRFKIGTTKRSTCLAKSRSFQEEGWFQENEDKREKKSEIKEKRERIDSQLSTQM*

DNA
ATGAACAATGGAGGTGGGGATGGTGGAAGTCAGCAAAGAGAATTACCTGGTAAGAGAAAGCTTTTCCGAGGCAGTGATTT
TGCGTTTTCCATAGCGAGAATGGCAGTGGCTCAAATATGCGAGAGTGTTGAGGTTAACTCGTATCAGGAATCACAGACAC
GCGAGGCCGTGAGGTTTAGTTCTTTTCATGAATCTGCTCTTGAAGCACTAACTGATGTAGCGGTTCAGTATATCCAGAGC
ATTGGGAAGACTGCCCATTTGTATGCTAACATAGCCGGTAGAGTAGATGGTAATTCTCTGGATATTGTTCAAGCATTAGA
GGATTTGGGATCTGGTTTGGGTTTTGCTGGTTTTTCAGATGCTGACCATTGTCTTGCTGATTCCGGTGTACTCAAGGATA
TTATTCATTATACTGGAGAAGCGGAGGAGATGCCGTTTGTTTACTCTCTTCCTCGTTTCCCATTTAGTAAAGAGAAAAAA
CCTGCTCCTAGTTTCTCTGAGGTTGGACCAGAACCTCCAGATGAACACATTCCTATTTGGCTTCCTGCATTTCCCAAAAC
CAAATTGTGTGATCGATCAGAGGAAACTAATGCAGCCACAATCGAAGGAGAAATTCCGAGGAAAGAAAACGGTTCATCTT
TACCGAGTATGCAACATTCTTTCGATGGTGGTAGGTTAGATATACATACATCTCCAAAGGATGTTCGAGAATCACCAAAA
GCAGTAGTCGAAGGTAACCCGTTTCTAACTGCGCCTCTTCGAATTGTGGAGAAAAATGTGTCACCTGTGGTCCGCCCTTT
GGAGATTTCAAATGAAGTTGTTAGGACCAACCACGTTGCTGATAAGCATATGAGCAACAACCATCACATCCCAGTTCTTG
AGGCATCTGCTTCATCGGATAAAATCAACAACATGAACTGGTTAGCTGAATCCGAGGATGGAGAGAAGGAAGATGTTGCA
AGAAAACAACGAACTTTGGTACGTTTCAAGATTGGGACTACAAAAAGATCTACATGTTTGGCAAAAAGTCGGAGCTTCCA
GGAAGAGGGATGGTTTCAAGAAAATGAAGACAAGAGGGAGAAGAAGTCAGAAATCAAAGAAAAGCGCGAAAGAATTGACT
CGCAATTGTCAACTCAGATGTAA