Details for Lyrate rockcress Locus 16065071

Position : sca3 ( 5`- 4607881 .. 4605851 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317933 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065071

Protein [Map View]
MAKVLKSSQSCHFPSPSSSSSSSSTSCGGNDGGNRDPHSPFNISRREEEEEEERSEKERERFELSSALEILVSAIRRSVI
GGCVGEEDLCSMEIGVPTDVRHVAHVTFDRFHGFLGLPVEFEPEVPRRAPSASATVFGVSTESMQLSYDTRGNVVPTILL
MMQSHLYSRGGLRVEGIFRINGENAQEEYIREELNKGIIPDNIDVHCLASLIKAWFRELPSGVLDSLSPEQVMESESEDE
CVELVRLLPSTEASLLDWAINLMADVVEMEQLNKMNARNIAMVFAPNMTQMLDPLTALMYAVQVMNFLKTLIVKTLKDRK
ESRDKLVPASNPSPRDHNGDQSSSRQLLHLMKANKGESLDNFEAEMKDKEESADEEEEEEECVESRELVDIKNSSLVNSN
NGGFGQKHNGWEEQRTMSKASSIVGRVNYRVELFEAWR*

DNA
ATGGCTAAAGTTCTTAAATCGAGCCAATCATGTCATTTCCCTTCACCTTCAAGCTCTTCTTCTTCTTCTTCTACATCATG
TGGAGGCAATGATGGTGGTAATAGAGACCCACATTCTCCTTTTAACATTTCTCGTCGCGAGGAAGAAGAAGAGGAGGAGA
GAAGCGAGAAAGAGAGAGAAAGATTTGAGCTTTCTTCTGCATTGGAGATTTTAGTTTCTGCTATTAGAAGGTCTGTGATT
GGTGGGTGTGTTGGTGAAGAGGATCTTTGTTCAATGGAGATTGGTGTTCCCACAGATGTTAGACATGTCGCTCATGTCAC
CTTTGATCGTTTCCATGGCTTCCTTGGCTTGCCTGTTGAGTTTGAACCTGAAGTCCCAAGACGAGCTCCTAGTGCAAGTG
CTACCGTGTTTGGAGTCTCTACCGAGTCAATGCAGCTATCATATGATACTAGAGGGAACGTCGTGCCTACTATACTTTTG
ATGATGCAGAGTCACTTGTACAGTAGAGGCGGATTGCGGGTAGAAGGAATTTTCAGGATTAATGGTGAGAATGCTCAAGA
AGAGTACATAAGGGAAGAGTTGAATAAAGGTATTATACCTGATAACATCGATGTCCACTGCTTAGCAAGTCTCATTAAGG
CTTGGTTTAGGGAACTTCCTAGTGGCGTTTTGGATTCACTTTCACCAGAGCAAGTAATGGAGTCTGAGAGTGAAGATGAG
TGTGTGGAACTTGTAAGGCTTCTCCCTTCAACAGAAGCTTCTTTGTTAGATTGGGCTATCAATCTAATGGCTGATGTTGT
TGAGATGGAACAACTTAACAAGATGAATGCTCGAAACATTGCCATGGTTTTTGCACCTAACATGACTCAGATGTTGGATC
CATTGACGGCTCTAATGTATGCTGTGCAAGTTATGAACTTTCTTAAAACACTTATTGTGAAGACGCTTAAAGACCGAAAA
GAATCTCGAGATAAGTTGGTTCCAGCCTCAAATCCGAGTCCTCGGGACCATAATGGTGATCAGAGCAGCAGTAGACAGTT
GTTGCATCTCATGAAAGCTAACAAGGGGGAAAGTTTAGACAACTTTGAGGCAGAGATGAAAGACAAAGAAGAGTCTGCAG
ATGAAGAAGAAGAAGAAGAAGAATGTGTGGAATCTCGAGAACTTGTTGACATAAAAAATTCTTCTCTGGTTAACAGCAAC
AATGGAGGTTTTGGACAGAAACACAATGGTTGGGAGGAGCAGAGAACCATGTCGAAAGCGAGTAGTATTGTGGGACGTGT
GAACTACAGAGTTGAGCTATTCGAAGCTTGGCGGTGA