Details for Lyrate rockcress Locus 16065051

Position : sca3 ( 5`- 12310730 .. 12311650 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480003 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065051

Protein [Map View]
MTTPSPTSSPPSDSNPNSAATPPHHKQQPPSPPPLTNPSSPPPQITVVALAASTSAVARKTQPVLWTHDETLLLIESYKE
KWYAIGRGPLKSTHWEEIAVAVSSRSGVERSSTQCRHKIEKMRKRFRSERQNMGPISIWPFYNQMEELDSNPAPISARPL
TRLPPNSNNHYKDDDDEDDDNYEEEEDEDERQSKSRSINYILRRPGTVNRFAGVGGGLLSWGQKERSSKRKRNDGDGGER
RRKGARAVAAEIRAFAERVMVMEKKKIEFVKETVRLRKEMEIRRINLIQSSQTQLLEFINNAFDSF*

DNA
ATGACGACGCCTTCGCCGACCTCCTCTCCTCCCTCTGATTCAAACCCTAATTCCGCCGCTACTCCGCCGCATCACAAACA
ACAACCACCCTCTCCTCCTCCACTCACGAATCCATCCTCTCCACCACCACAAATCACCGTCGTTGCCTTAGCCGCATCAA
CCTCCGCCGTCGCCAGGAAAACCCAACCAGTTCTCTGGACTCACGACGAGACTCTCCTCCTAATCGAATCCTACAAAGAG
AAATGGTACGCAATTGGTCGTGGTCCTCTCAAATCAACTCACTGGGAAGAAATCGCCGTCGCTGTCTCATCTCGTTCCGG
CGTTGAACGGTCATCTACACAGTGTAGGCATAAGATCGAGAAGATGCGTAAACGATTCCGATCTGAGAGACAGAATATGG
GACCTATCTCAATTTGGCCTTTCTATAATCAAATGGAGGAATTGGATTCAAATCCTGCTCCGATCTCAGCTCGTCCTCTC
ACTCGTCTTCCTCCTAATTCGAATAATCACTACAAAGACGACGATGACGAAGACGATGATAACTACGAAGAAGAAGAGGA
CGAAGATGAGAGGCAGAGCAAATCGAGAAGTATTAATTACATATTGAGAAGACCTGGTACTGTTAACAGATTTGCTGGAG
TTGGTGGAGGATTATTGTCATGGGGACAAAAAGAGAGATCATCGAAGAGGAAGAGGAACGACGGAGATGGCGGTGAGAGG
CGGAGGAAAGGAGCGAGAGCTGTTGCGGCGGAGATTAGGGCGTTTGCTGAGAGAGTAATGGTGATGGAGAAGAAGAAGAT
TGAGTTTGTTAAAGAGACAGTGAGGCTTCGTAAGGAAATGGAGATTAGAAGAATCAATTTGATTCAGAGTTCACAAACTC
AGCTTCTTGAATTTATCAACAATGCTTTTGATTCTTTCTAA