Details for Lyrate rockcress Locus 16064996

Position : sca3 ( 5`- 10609142 .. 10607472 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064996

Protein [Map View]
MYQSIDDDDDLLAALCFDQSNGVVDPYAYIQTNEDNIFQDFGSCGLNLQPQQEQFDSFSGNLEQVCSFRGENNGVVYSSS
IGSAQLDWAASFSGVLQQETHQVCGFRGQNDDSAANHLQQEQGQVCNGVVEINSSSSVGGVKEELEHGLSINRGRNGSCN
KPGTKACREKLRREKLNDKFMDLSSVLEPGRTPKTDKSAILNDAIRVVNQLRGEAHELKETNQKLLEEIKNLKAEKNELR
EEKLVLKADKEKMVQQLKSMAFPSPGFMPSQHPVAFHPNNMPVYSGYGYYPPNMPMWSPLPPADRDTSRDHKNLPPVA*

DNA
ATGTATCAATCAATTGACGACGATGATGATCTTCTCGCTGCTCTTTGTTTTGATCAAAGCAATGGAGTAGTAGATCCTTA
TGCATATATTCAGACAAATGAGGATAACATCTTTCAGGATTTTGGGTCCTGTGGTTTGAATCTGCAGCCACAACAAGAAC
AATTTGATTCTTTTAGTGGAAATCTTGAACAAGTTTGTAGCTTTAGAGGGGAAAACAATGGAGTTGTTTATAGTAGTAGT
ATTGGATCAGCACAATTGGATTGGGCTGCATCGTTTAGTGGAGTTTTGCAGCAAGAGACTCATCAAGTCTGTGGCTTTAG
AGGACAAAACGACGATTCTGCAGCAAATCATTTGCAGCAGGAACAAGGACAAGTGTGTAACGGTGTAGTGGAAATCAATT
CTTCCTCGTCGGTTGGAGGTGTTAAGGAAGAGTTAGAACATGGATTATCTATTAACAGGGGACGAAATGGATCATGTAAC
AAGCCAGGAACCAAAGCCTGTCGCGAGAAACTGAGAAGGGAAAAGCTAAATGACAAGTTCATGGACTTGAGCTCTGTTTT
GGAGCCTGGCAGGACTCCAAAGACGGATAAATCAGCTATACTCAATGATGCTATTCGGGTTGTGAATCAGCTTAGAGGTG
AAGCTCATGAGCTTAAAGAAACCAACCAGAAGCTTCTGGAAGAGATCAAGAATCTAAAGGCGGAGAAAAACGAGTTACGG
GAGGAAAAGCTGGTGTTGAAGGCGGATAAGGAGAAGATGGTGCAACAGTTGAAATCTATGGCGTTTCCATCACCGGGTTT
CATGCCCTCACAGCATCCAGTAGCTTTCCATCCCAATAATATGCCGGTTTATTCGGGTTACGGTTACTATCCTCCAAACA
TGCCAATGTGGTCACCCTTACCTCCTGCTGACCGTGATACGTCTCGTGATCACAAAAACCTTCCTCCTGTTGCTTAA