Details for Lyrate rockcress Locus 16064968

Position : sca3 ( 5`- 1215294 .. 1216896 -3` )
Annotation : [B2G] set domain-containing protein
External links : CoGe
PGDD synteny : 16064968

Protein [Map View]
MQRESPPKKRCLGEAPDIIPATELFFRCANLILPCLNPQELGAVSQTCKTLSLISKSITFHRSLDAARSLENLSIPFHNS
IDSQRYAYFIYTPFQIPASSPPPRQWWGAATECGSESRPCFDSVSERGRFGVSLLDESGCECERCEEGYCKCLAFVGMEE
IGNECGSGCGCGSDCSNRVTQKGVSVSLKIVRDEKKGWCLYADQLIKQGQFICEYAGELLTTDEAHRRQNIYDKLRSTQS
FASALLVIREHLPSGQACLRINIDATRIGNVARFINHSCDGGNLSTVLLRSSGALLPRLCFFAARDIIAEEELSFSYGDV
RVTGENRDNKLNCCCGSSCCLGTLPCENT*

DNA
ATGCAGCGAGAGTCACCACCGAAGAAGCGTTGTCTCGGAGAAGCTCCAGACATTATTCCGGCCACCGAACTATTTTTCCG
ATGTGCGAACTTAATTCTTCCATGCCTAAACCCTCAAGAACTCGGCGCTGTCTCTCAAACCTGCAAAACCTTATCCCTAA
TTTCCAAATCTATAACCTTTCACCGATCCCTTGACGCTGCACGATCCTTGGAAAACCTCTCAATCCCGTTTCACAACTCC
ATCGATTCTCAACGATACGCTTACTTCATCTACACACCATTTCAGATTCCCGCGTCATCTCCTCCGCCGCGACAATGGTG
GGGAGCTGCTACTGAATGTGGATCCGAGTCGAGACCTTGTTTTGACTCAGTGAGTGAACGCGGACGTTTTGGAGTGAGTC
TACTGGACGAGTCAGGATGCGAATGCGAGAGGTGTGAGGAAGGATACTGCAAGTGTTTAGCTTTCGTTGGGATGGAGGAG
ATTGGTAATGAATGCGGGTCGGGTTGTGGATGCGGGTCGGATTGTTCAAACCGGGTTACACAGAAGGGGGTTTCGGTTAG
TTTGAAGATTGTAAGAGATGAGAAGAAAGGTTGGTGCTTGTACGCTGATCAGCTTATCAAGCAAGGCCAATTCATCTGTG
AATATGCAGGTGAGCTATTGACAACAGATGAAGCACATAGACGTCAAAACATTTACGACAAACTGAGATCAACGCAATCT
TTCGCTTCGGCTCTTTTGGTCATACGCGAACACCTCCCTTCAGGACAAGCTTGTTTAAGGATAAACATCGATGCCACAAG
AATTGGGAACGTTGCTAGATTCATCAACCATTCTTGTGACGGCGGAAATCTCTCCACCGTTCTGTTGAGAAGCTCAGGAG
CATTGCTTCCTAGGCTCTGTTTCTTTGCAGCAAGGGACATAATTGCAGAGGAGGAGTTAAGTTTCAGTTATGGAGACGTC
CGTGTCACCGGAGAGAACAGAGACAACAAGTTAAATTGCTGTTGTGGTAGTTCCTGCTGTTTGGGAACGTTGCCTTGTGA
GAATACCTGA