Details for Lyrate rockcress Locus 16064960

Position : sca3 ( 5`- 3456625 .. 3455247 -3` )
Annotation : [B2G] elongation factor p (ef-p) family protein
External links : CoGe
PGDD synteny : 16064960

Protein [Map View]
MAGRAIFSVSSCSPSLCIPYSTASFSSMNRLALPAVRISPRTNRFPRIHCSLSANDIKAGTNIEVDGAPWRVLEFLHVKP
GKGAAFVRTKIRNYVNGSTVERTFRAGISVEEANIYKETKQFTYKDGSQFVFMDLTTYEETRLNESDMGEKTKWLKEGME
CILLYWKDKVIDFDLPITVKLKVVDVDPGLRGDTVQGGSKPATMETGAIVAVPLFINVGEEIFVDTRTGAYMNRA*

DNA
ATGGCCGGAAGAGCGATTTTCTCTGTATCATCATGTTCTCCTTCCTTGTGCATCCCTTATTCAACTGCTTCTTTTTCATC
GATGAATCGATTGGCGCTCCCTGCCGTGCGGATATCTCCCCGAACCAACAGATTTCCCAGGATTCACTGCTCTTTGTCTG
CTAATGACATCAAAGCCGGAACCAATATCGAAGTCGATGGTGCTCCTTGGCGTGTACTTGAGTTTCTTCATGTCAAACCA
GGAAAAGGTGCGGCATTTGTGAGGACCAAGATCAGGAACTATGTAAATGGTAGCACAGTGGAGCGAACATTTCGTGCTGG
GATTTCTGTTGAGGAAGCTAATATATACAAAGAAACCAAACAATTCACATACAAAGATGGGTCTCAGTTTGTTTTCATGG
ATTTGACCACATATGAAGAAACACGTCTTAACGAATCTGATATGGGTGAGAAGACGAAATGGTTGAAAGAAGGAATGGAA
TGTATTTTGCTGTATTGGAAAGACAAGGTTATCGATTTCGATCTACCGATTACAGTTAAGCTAAAAGTGGTGGACGTTGA
TCCTGGCCTTCGCGGTGATACTGTGCAAGGTGGATCCAAACCGGCGACAATGGAAACGGGTGCAATAGTTGCTGTACCAC
TCTTTATTAACGTCGGTGAAGAGATATTCGTGGATACTAGAACTGGTGCATACATGAACCGGGCGTGA