Details for Lyrate rockcress Locus 16064959

Position : sca3 ( 5`- 1956909 .. 1960099 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477819 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064959

Protein [Map View]
MWMGVGDYSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDKGKVLK
EVKQADAIVLTFAFDRPETLDRLSKHWLPLFRQLEVRVPIIVAGYEVDSKEAYNQTSIEQITSPMMQRYREVETSIQWSA
QRLNQATKVLYYAQKAVIHPVGPVFNQETNSLKPRCIAALKRIFLLSDHNVDGILSDAELNELQKKCFDTPLVPCEINQM
KKAMQVKFPQGVNERGLTLDGFLFLNTRYIEDARIQTLWTMLRKFGYNNDLRLGDDLIPYSSFKREADQSVELTNVAIEF
LREVYEFFDNDCDNNLEPHETGYIFETAPESPWTEAPYKDVTEETKDGGLSLEAFLSLWSLMTLIDPARSLEYLMYIRFP
YDPSSAIRVTRKRVLDRKEKKSERKVVQCFVFGPKNAGKSAFLNHFIGRSYDDDSNNNNGSTDERYAVNMVKESGVVANT
DKTLVLKEIRIQEDGFMLSNKALAACDVAIFIYDSSDESSWNRAIDLLAEVATIGKDAGYVFPCLMVAAKTDLDPFPMAI
QESTRVTQDIGIDAPIPISSKLGDFGNLFRKILTAAEHPHLNIPAIESKKKRSCKLINRSLMAVSIGTAALIAGLASFRL
YTARKLS*

DNA
ATGTGGATGGGTGTGGGAGATTATAGTGGCTCGCCAAAACCGATAAGAATTGTTGTGGTTGGTGAGAAGGGCAGTGGAAA
ATCAAGCTTGATTATGGCTGCAGCAAGAAACACTTTCCATCCAAACATCCCTTCTCTGTTACCTTACACCAATTTACCTT
CTGAATTCTTCCCTGACCGTATACCCGCTACTGTTATCGACACTTCTTCAAGACCGGAAGATAAGGGAAAGGTACTTAAG
GAAGTTAAGCAAGCAGATGCAATTGTTTTAACATTTGCATTCGATAGACCGGAGACTCTTGACCGTTTGAGTAAACACTG
GCTTCCTCTGTTTCGACAATTAGAGGTGAGAGTTCCTATCATAGTGGCAGGTTATGAAGTTGACAGCAAAGAGGCTTATA
ATCAAACCAGCATTGAACAAATAACGTCACCTATGATGCAACGATATCGAGAGGTCGAGACATCTATCCAGTGGTCTGCT
CAGAGGCTAAATCAGGCTACAAAGGTACTCTACTATGCACAAAAAGCAGTTATTCACCCAGTAGGACCTGTGTTTAATCA
AGAAACCAATTCACTGAAGCCTCGCTGTATCGCTGCCTTGAAACGAATCTTTTTACTCTCTGATCATAACGTGGATGGTA
TTCTCAGTGACGCCGAGTTAAACGAGCTTCAGAAGAAATGCTTCGATACACCATTGGTGCCTTGTGAAATTAACCAAATG
AAAAAAGCTATGCAAGTCAAGTTTCCACAAGGAGTTAATGAAAGAGGACTCACATTGGATGGTTTCTTGTTTCTAAACAC
ACGTTATATCGAAGATGCAAGAATCCAAACACTATGGACTATGCTTAGGAAATTCGGGTACAATAACGATCTAAGACTTG
GAGATGATCTGATTCCTTATTCATCATTCAAACGTGAGGCTGATCAGAGTGTTGAGCTAACAAATGTAGCTATTGAATTC
TTAAGGGAAGTCTATGAGTTTTTTGATAATGACTGTGACAATAACTTGGAACCTCATGAAACGGGATACATCTTTGAAAC
TGCACCTGAAAGTCCTTGGACTGAAGCTCCTTATAAGGATGTCACAGAGGAAACTAAGGATGGAGGATTATCTCTGGAAG
CTTTCCTCTCACTGTGGTCATTGATGACACTAATAGATCCAGCTAGGAGTCTTGAATATTTGATGTACATTAGATTCCCA
TATGATCCATCTTCAGCGATTCGCGTAACTAGGAAGCGAGTTCTAGATCGCAAGGAGAAGAAATCTGAAAGAAAAGTTGT
TCAGTGTTTTGTGTTTGGCCCCAAGAATGCTGGAAAGTCTGCATTCCTCAATCATTTTATCGGAAGGTCATACGATGATG
ACAGCAACAACAACAATGGATCAACAGATGAACGTTATGCTGTAAATATGGTTAAAGAATCTGGAGTGGTTGCAAATACA
GATAAAACTCTGGTGCTGAAGGAAATTCGAATTCAAGAAGATGGATTCATGTTATCAAATAAAGCATTGGCTGCTTGTGA
TGTAGCTATCTTCATCTATGATTCTTCTGATGAGTCCTCGTGGAACAGAGCCATTGACTTGCTTGCTGAGGTCGCAACCA
TTGGCAAAGATGCTGGTTATGTGTTTCCCTGCTTAATGGTTGCAGCAAAAACTGATCTTGATCCATTCCCAATGGCGATT
CAAGAATCAACTAGAGTTACACAAGATATAGGGATTGATGCTCCAATACCAATCAGCTCTAAACTGGGAGATTTCGGTAA
CTTATTTCGAAAGATCTTAACCGCGGCAGAGCATCCTCATTTGAATATTCCAGCGATAGAGTCAAAGAAGAAAAGGAGTT
GCAAGCTAATCAACAGATCTCTAATGGCGGTTTCAATCGGGACAGCGGCTTTGATCGCCGGGCTGGCTTCATTCCGTCTC
TACACCGCAAGAAAGCTGAGTTAA