Details for Lyrate rockcress Locus 16064951

Position : sca3 ( 5`- 9452694 .. 9453818 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064951

Protein [Map View]
MEGLESVYAQAMYGMTRESKIMEHHQGSDLIWGGNELMARELCSSSSFHHQLINPNLSSCFMSDLGVIGEIQQQQHVGNR
ASSIDPSSLDCLLSATSNSNNTSTEDDEGISVLFSDCQTLWSFGGVSSAESENREVTNETTTTIKPKSLKRNRGGDGGTT
ETTTTTTTKPKYVKRNRGDETGSHFSLLHPQDDSEKGGFKLIYDENQSKSKKPRTEKERGGSSNISFQHSTCLSDNVEPD
AEAIAQMKEMIYRAAAFRPVNFGLEIVEKPKRKNVKISTDPQTVAARQRRERISEKIRVLQTLVPGGTKMDTASMLDEAA
NYLKFLRAQVKALENLRPKLDQTNLSFSSAPSFPLFHPSFLPLQNPNQIHHPGC*

DNA
ATGGAAGGATTGGAATCTGTGTACGCTCAAGCTATGTATGGAATGACCCGAGAAAGCAAAATCATGGAGCATCATCAAGG
ATCAGATTTGATTTGGGGAGGAAATGAGCTAATGGCTCGAGAACTCTGTTCTTCTTCTTCTTTTCACCACCAACTCATTA
ATCCGAATCTTAGCAGCTGTTTCATGTCTGATCTTGGAGTCATAGGTGAGATTCAACAGCAGCAACATGTTGGAAACAGA
GCTAGTTCGATAGATCCATCATCACTCGATTGTTTGTTATCGGCGACGTCGAACAGCAACAACACTTCGACGGAAGACGA
TGAAGGGATTTCTGTGCTTTTCTCAGATTGTCAGACTCTTTGGAGCTTTGGTGGGGTCTCATCTGCAGAGTCTGAGAACA
GAGAGGTCACTAATGAGACGACAACAACGATAAAGCCTAAGTCTTTGAAGAGAAACAGAGGAGGAGATGGAGGAACTACT
GAGACGACAACAACCACAACAACAAAGCCTAAGTATGTGAAGAGAAACAGAGGAGACGAGACAGGAAGTCACTTCAGTCT
TCTTCATCCTCAAGATGATTCGGAGAAAGGAGGTTTCAAGCTTATCTACGATGAGAATCAATCGAAATCAAAGAAACCAA
GAACAGAGAAAGAACGAGGCGGTTCTTCAAACATTAGCTTCCAACATTCAACTTGTTTGTCTGACAATGTCGAGCCCGAT
GCTGAGGCGATTGCGCAGATGAAGGAGATGATATACAGAGCGGCTGCGTTTAGACCGGTGAATTTCGGGTTAGAGATTGT
GGAGAAACCTAAGAGAAAGAACGTGAAGATATCGACGGATCCTCAAACGGTTGCAGCGAGACAGAGAAGGGAGAGGATAA
GTGAGAAGATTAGGGTTTTACAAACATTAGTTCCAGGTGGGACGAAGATGGACACAGCTTCAATGCTTGATGAAGCTGCT
AATTATCTCAAGTTCCTTCGAGCACAAGTAAAGGCTTTAGAAAACTTGAGACCCAAGCTTGACCAAACCAATCTCTCTTT
CTCTTCTGCTCCTTCGTTTCCCTTATTCCACCCATCTTTTCTTCCATTGCAAAACCCTAATCAAATCCATCATCCAGGGT
GTTGA