Details for Lyrate rockcress Locus 16064946

Position : sca3 ( 5`- 9700443 .. 9699558 -3` )
Annotation : [B2G] CYCP2_1 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064946

Protein [Map View]
MLTVAGDDELDPVVGPEPPTEAATPRVLTIISHVMEKLVARNEWLAKQTTGFGKSLEAFHGVRAPSISIAKYLERIYKYT
KCSPACFVVGYVYIDRLAHRHPGSLVVSLNVHRLLVTCVMIASKILDDVHYNNEFYARVGGVSNADLNKMELELLFLLDF
RVTVSFRVFESYCFHLEKEMQLNGDVSSLKDIQPMQESLSPSSSLSSLYE*

DNA
ATGTTAACCGTAGCCGGAGACGATGAACTAGACCCGGTCGTGGGACCAGAGCCGCCAACGGAAGCAGCCACTCCAAGAGT
GTTGACTATAATCTCCCATGTGATGGAGAAGCTCGTGGCACGAAACGAGTGGTTAGCTAAGCAAACTACGGGATTCGGGA
AGAGCTTGGAGGCATTTCACGGTGTCAGAGCACCAAGCATAAGTATAGCAAAGTACCTTGAGAGGATATACAAGTACACA
AAATGTAGCCCGGCGTGTTTCGTTGTTGGGTATGTGTACATAGACCGGTTGGCTCATAGGCATCCTGGTTCTTTGGTTGT
CTCCTTGAATGTTCATAGACTCCTCGTCACTTGCGTCATGATTGCTTCCAAGATACTAGACGACGTGCACTACAACAACG
AGTTCTATGCTCGGGTAGGAGGCGTGAGCAATGCGGACCTGAACAAAATGGAGTTAGAGCTTCTATTTCTTCTTGACTTT
AGAGTTACAGTGAGTTTTAGAGTTTTTGAGAGCTATTGCTTTCACCTCGAAAAAGAGATGCAACTAAACGGCGACGTTTC
TTCCCTCAAAGATATTCAACCAATGCAAGAAAGTCTCTCTCCTTCATCCTCTTTATCATCTTTATATGAATGA