Details for Lyrate rockcress Locus 16064944

Position : sca3 ( 5`- 7752687 .. 7750839 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064944

Protein [Map View]
MSQPSVILATASYDHTIRFWEAETGRCYRTIQYPDSHVNRLEITPDKRYLAAACNPHIRLFDVNSNSPQPVMTYDSHTNN
VMAVGFQCDGKWMYSGSEDGTVKIWDLRAPGCQKEYESVAAVNTVVLHPNQTELISGDQNGNIRVWDLRANSCSCELVPE
VDTAVRSLTVMWDGTMVVAANNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTVKIWNV
DGFKLEKVLTGHQRWVWDCVFSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHKATVCCALHD*

DNA
ATGAGTCAGCCTTCTGTGATTCTTGCTACAGCTAGCTATGATCACACGATTCGATTCTGGGAAGCCGAAACTGGTCGCTG
TTACCGTACCATTCAGTATCCTGATTCGCATGTAAATAGGCTTGAGATAACCCCAGATAAGCGTTATCTAGCTGCAGCTT
GTAATCCTCATATACGGCTCTTTGATGTCAACTCCAACAGTCCTCAACCTGTGATGACTTATGATTCACACACCAACAAT
GTTATGGCAGTAGGATTCCAATGTGATGGGAAATGGATGTATTCAGGATCAGAGGATGGTACAGTTAAGATCTGGGACTT
GAGGGCTCCCGGTTGCCAAAAGGAGTATGAAAGTGTTGCCGCAGTTAACACAGTTGTTTTACACCCAAATCAGACTGAAT
TGATATCTGGAGACCAAAATGGAAATATACGTGTATGGGATCTCAGAGCAAATTCGTGTAGCTGCGAACTGGTACCAGAA
GTTGATACAGCTGTACGGTCTTTAACGGTTATGTGGGATGGGACAATGGTGGTTGCTGCTAACAACCGTGGAACATGTTA
TGTATGGCGCTTGTTGCGTGGAAAACAGACGATGACCGAGTTTGAACCCCTTCATAAGCTGCAAGCTCATAATGGCCACA
TCCTTAAATGCCTTCTCTCTCCTGCAAACAAGTATCTAGCAACCGCATCGTCTGATAAAACCGTCAAAATATGGAATGTC
GATGGTTTCAAATTAGAGAAAGTTTTAACAGGACATCAAAGATGGGTCTGGGACTGCGTCTTCTCAGTGGATGGAGAATT
TCTTGTAACAGCATCATCAGACATGACGGCTAGATTATGGTCGATGCCAGCGGGTAAAGAAGTGAAGGTATACCAAGGTC
ATCACAAAGCCACTGTGTGCTGTGCACTCCACGATTAA