Details for Lyrate rockcress Locus 16064905

Position : sca3 ( 5`- 8552442 .. 8554751 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064905

Protein [Map View]
MENTDVFLGLHDFLERMRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCATVQEFFSKMEAAFRAHPLWSGCSEEELDSAGD
GLEKYVMTKLFTRVFASNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCIL
NCCKVINNLLLNASIASNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNI
DAKSLSLDEAEFEKNMESARARISGLGSQSYQTGHGTAPPPRDESTLQKTQSLNPKRENTLFQSKSSDSLSGTNEILNIN
SETPMKKAESISDLENKGATLLKDTEPSKVFQEYPYLFASAGDLRIGDVEDLLNNYKQLVFKYVCLTKGLGDATSLAPSS
SPLQALSGFDTYKESEDHTTSSSDVQMTRETDSSVDDLIRALQGEGEDVNNLSDVKHEEYGAMLVERKDEERDPKMLGEA
DAKDTDLIKHIPKRESENSSSRPAEDEDVGSKHPVAEASE*

DNA
ATGGAGAACACGGACGTCTTCTTGGGGCTGCATGATTTTCTGGAACGGATGCGCAAACCCTCCGCCGGCGATTTCGTCAA
ATCCATTAAAAGTTTCATTGTTTCATTCTCGAACAATGCACCAGACCCGGAAAAAGATTGTGCTACTGTTCAGGAGTTCT
TTTCTAAGATGGAGGCTGCTTTCAGGGCTCATCCACTTTGGTCTGGTTGTTCTGAGGAGGAATTGGACAGTGCAGGAGAT
GGCCTGGAGAAGTATGTTATGACAAAGCTATTTACCCGGGTATTTGCCTCAAACACTGAGGAGGTTATAGCTGATGAGAA
ACTCTTTCAAAAGATGTCATTGGTTCAACAATTCATTTCTCCTGAGAATTTGGATATACAACCAACTTTTCAAAACGAAT
CATCATGGCTGCTAGCTCAAAAAGAGCTCCAGAAGATAAACATGTACAAAGCACCTCGTGATAAGCTTGTGTGTATCCTT
AACTGTTGCAAAGTGATAAATAACTTACTGCTAAATGCTTCAATTGCTTCAAACGAGAATGCACCTGGAGCAGACGAATT
TCTTCCTGTTTTGATATATGTTACAATAAAGGCTAACCCTCCACAACTTCACTCAAACTTGTTGTATATACAAAGATATA
GGCGTGAATCTAAACTTGTTGGTGAAGCTGCGTACTTCTTCACAAACATACTCTCTGCAGAGTCTTTCATCTCTAATATT
GATGCAAAATCTCTTTCATTGGATGAAGCTGAGTTTGAAAAGAACATGGAATCTGCACGGGCACGAATTTCTGGTTTGGG
CAGCCAGTCTTATCAAACTGGTCATGGCACTGCACCACCCCCTCGTGATGAGTCCACTCTTCAGAAAACTCAAAGTCTGA
ATCCCAAGAGGGAAAACACTCTTTTCCAATCAAAATCGTCTGATAGTCTTTCTGGGACCAACGAAATACTGAATATAAAC
AGTGAAACACCAATGAAGAAAGCTGAATCTATTTCAGATTTGGAAAATAAGGGTGCGACGCTTTTGAAGGATACCGAGCC
AAGCAAAGTCTTTCAAGAATATCCTTACTTATTTGCCAGTGCTGGTGATCTGAGGATAGGAGATGTTGAGGACTTGTTAA
ATAATTATAAACAGCTCGTTTTCAAATATGTGTGCCTTACCAAAGGATTGGGTGATGCAACATCTTTAGCTCCATCCAGT
TCACCCTTGCAAGCGTTGTCCGGTTTTGATACGTATAAGGAATCTGAGGATCATACAACATCGTCTTCAGATGTACAAAT
GACAAGGGAAACTGACAGCAGTGTTGATGATTTGATCCGAGCTCTACAAGGTGAAGGGGAAGATGTTAATAATTTGTCAG
ATGTAAAACATGAAGAATATGGCGCAATGTTGGTAGAGCGAAAGGATGAAGAACGTGATCCCAAGATGCTAGGAGAAGCA
GATGCCAAAGATACTGATTTGATTAAGCACATTCCTAAGAGAGAAAGTGAGAATTCTAGTTCCCGACCTGCAGAAGATGA
AGATGTTGGTTCCAAACACCCAGTTGCGGAAGCTTCTGAGTGA