Details for Lyrate rockcress Locus 16064880

Position : sca3 ( 5`- 3606734 .. 3601197 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064880

Protein [Map View]
MKLSQKLKKPSSSTKLILQEIIGLTTTNANGLASVTCSSKCVYLAGCVVVVYDVGSFTQSHLVVSHRMPKPLSCVAVSQN
GRFVAAGERTRSSKVGSLAFHGKQTDNGFQKGNSFVSVVSINRVNSSGIDEQSDEFISIYALTEAGVGVLMLMSYGMLIN
KSVDLKVEKCFALSASSGLIACACSKGMVQLFTPETLDYAGTIQFSDAKSSNTENQSHSAELKNTESPPVIFPDAVACQF
STKDKLVVIYGDRSLYVWDVNDVNKPTRCSMMISHSAGIWDIKNLSCGNLHSPTAACVARGCSEGVSFTTCSEDGTIRLW
DLAFEVGPAANASSNPSESSTQGIMHLASAGIFERDLVETCGSKFGFRALVVSEDGKYLAAGDCGGNLHIYDLQESEYTC
FTDAHEAEIQSLSFSSPGLKDVDSENASSSDFLLVSGGKGRAIHIYDVKRNFDPVGSVCGSAAVTSVKFACNGQKMLTSG
ADRLQLFDVVRKASSVRLSPSHPKTLSHGTIYDVVVDPTSGLVVTVGQDKKINIFDIGSGKLVRSFKQDRDHGDPLKVIL
DPSYSYLVCSYSNRTICFVDFVTGELVAQATGHGEAVTGVIFLPDCKHIISVASDGCIFVWKLPLRMATRIIQAVNENGR
LTVAQLEKFKQIAVDLEEDNPKDASCSANYKPVEENADQMQQQRSPWTSSFKFSVSRLPKWAQAKVETSDIATNCQDSIS
NQKHEDESLANTVVDCAEECSSVNLDCQTPKQGSKAENSCLGSLSKSSSDTETSVLQRDDPSHKKEKTRWNTIYNVCLDL
LNSPNIQAPFIIQQKPENFCTKHSAGHGGMLKQFDNSLSMIDEVEAEKSSQQRRYSSQFFLRRDYIGGSKQFMRTPSQKS
GYKTLRSIQEHLPLDTVKDQSSHSSEEHPEQDKTSSEVFHDTLADDSLQERITSCRQALHGLNAAAAVFVQSMSELSTAS
PRDQISGELRDQLFDEAALMIPKLSHKVNEVVAKIMPAHKNRNSDRMFSN*

DNA
ATGAAGCTAAGCCAGAAATTAAAGAAGCCTAGTTCATCCACCAAGCTAATTCTACAAGAGATCATCGGTTTGACGACAAC
AAACGCCAATGGATTGGCATCAGTTACTTGCAGCTCGAAATGTGTTTACTTGGCGGGATGTGTTGTGGTAGTCTACGATG
TAGGTTCTTTCACTCAATCGCATCTTGTTGTATCTCATCGTATGCCTAAGCCTTTGAGCTGTGTTGCGGTTTCGCAGAAT
GGGCGATTTGTAGCTGCTGGAGAGAGGACACGTTCAAGTAAAGTAGGATCTTTGGCATTTCATGGAAAGCAAACTGATAA
TGGTTTTCAAAAAGGAAACTCGTTTGTGTCAGTGGTATCAATCAATAGAGTGAACTCTAGTGGAATTGACGAACAAAGTG
ACGAATTTATCTCAATATACGCTCTCACAGAAGCAGGTGTAGGTGTTCTAATGCTCATGAGTTATGGGATGTTAATCAAC
AAGTCGGTGGATTTGAAGGTTGAAAAATGTTTTGCTCTATCTGCATCCAGTGGATTGATAGCCTGCGCTTGCAGCAAGGG
AATGGTCCAGCTATTTACGCCTGAAACTTTAGATTATGCTGGCACAATACAATTTTCAGATGCTAAAAGCAGCAACACTG
AAAATCAGTCTCATTCAGCAGAACTCAAAAATACAGAATCTCCGCCTGTTATTTTTCCGGACGCAGTTGCTTGCCAGTTT
TCTACCAAAGATAAGCTCGTTGTCATCTATGGGGATCGTAGTCTCTATGTTTGGGATGTGAACGATGTGAACAAGCCTAC
TAGGTGCTCGATGATGATATCACATTCTGCCGGAATTTGGGATATCAAAAACCTCTCTTGTGGAAATTTGCACAGTCCAA
CAGCTGCATGTGTAGCTAGGGGATGCAGTGAAGGGGTTTCCTTCACTACATGTTCTGAAGATGGAACCATCAGGTTGTGG
GATCTTGCTTTTGAAGTGGGTCCAGCAGCCAACGCAAGCAGTAATCCCTCAGAATCTTCCACACAAGGGATTATGCATTT
AGCTAGCGCTGGAATTTTTGAACGTGATCTCGTTGAGACATGTGGTAGCAAATTTGGTTTCCGAGCACTGGTAGTAAGTG
AAGATGGAAAGTACTTAGCAGCTGGGGACTGTGGAGGGAACCTTCATATATATGACCTACAAGAATCAGAATATACATGC
TTTACGGATGCTCATGAAGCAGAAATTCAGTCATTGAGCTTCAGCTCTCCTGGACTGAAAGACGTTGATTCTGAAAATGC
CTCAAGCAGCGATTTCTTGCTTGTTTCTGGTGGGAAGGGCCGAGCGATCCACATTTATGATGTCAAAAGGAACTTTGATC
CCGTTGGAAGTGTTTGTGGTTCAGCTGCTGTAACTTCTGTTAAATTTGCATGTAATGGCCAGAAAATGTTAACTTCTGGT
GCAGATAGGTTGCAGCTGTTTGACGTTGTCAGAAAAGCAAGTAGTGTGCGTCTTTCACCTTCTCATCCTAAAACTCTCTC
TCATGGAACCATCTATGATGTGGTTGTAGATCCAACATCAGGACTTGTTGTCACAGTGGGACAGGATAAGAAGATAAACA
TATTCGACATAGGCAGTGGAAAGCTTGTTAGATCATTCAAGCAAGACAGAGACCATGGAGATCCCTTAAAGGTCATTTTG
GACCCAAGCTACAGCTACTTAGTATGCTCCTACTCTAACAGGACAATCTGCTTTGTCGATTTCGTCACCGGAGAGTTGGT
TGCTCAGGCCACAGGACATGGTGAAGCTGTGACTGGTGTTATTTTCCTACCTGATTGCAAACATATCATTTCAGTTGCAA
GTGACGGCTGTATTTTTGTCTGGAAACTTCCTCTGCGAATGGCTACTCGTATTATACAGGCAGTAAATGAAAATGGCAGG
TTAACTGTGGCCCAACTTGAAAAGTTCAAGCAAATTGCGGTTGATTTGGAGGAAGACAATCCAAAAGATGCATCATGTTC
TGCAAACTATAAGCCAGTAGAAGAGAACGCAGATCAGATGCAGCAGCAACGCTCCCCATGGACATCCTCATTTAAGTTCA
GCGTTTCTCGACTTCCTAAGTGGGCTCAAGCTAAAGTGGAAACATCTGATATTGCTACCAATTGTCAGGATTCCATTTCA
AACCAGAAACATGAAGATGAAAGTCTGGCAAATACTGTTGTTGACTGTGCTGAAGAATGCTCTTCTGTAAATCTTGATTG
CCAAACTCCCAAACAAGGTTCAAAAGCCGAAAATTCATGCCTTGGAAGTCTTTCCAAAAGCTCCAGCGATACTGAAACTT
CAGTGCTTCAAAGAGATGATCCTAGCCACAAGAAAGAAAAAACCCGTTGGAACACTATCTACAACGTGTGTTTGGATCTT
CTAAATTCTCCAAACATCCAAGCACCTTTCATTATACAACAGAAACCTGAGAATTTCTGCACCAAACATTCTGCCGGGCA
TGGGGGCATGCTCAAGCAGTTTGATAACAGTTTGTCAATGATAGACGAGGTTGAGGCCGAAAAATCATCGCAGCAAAGAA
GATATTCTTCCCAGTTTTTCCTAAGAAGAGACTACATCGGCGGAAGCAAACAATTTATGCGTACGCCCTCCCAGAAATCA
GGGTACAAGACTTTGAGGTCGATCCAAGAACATCTCCCTCTTGATACGGTGAAAGATCAATCTTCACATAGTTCAGAAGA
ACATCCTGAACAGGACAAGACGTCTTCAGAAGTATTCCATGATACACTTGCAGACGATTCACTTCAAGAAAGGATAACTT
CCTGCCGTCAAGCATTACACGGTTTAAACGCTGCTGCTGCGGTTTTCGTCCAGTCAATGTCGGAATTATCTACAGCTTCT
CCCCGAGATCAAATCTCAGGTGAACTTAGAGATCAGTTGTTTGATGAAGCAGCTCTGATGATTCCAAAATTGTCTCATAA
AGTTAATGAAGTTGTTGCCAAGATAATGCCTGCGCACAAAAATAGAAACAGTGATAGAATGTTCTCCAATTAG