Details for Lyrate rockcress Locus 16064873

Position : sca3 ( 5`- 6597864 .. 6599648 -3` )
Annotation : [B2G] phospholipase carboxylesterase family protein
External links : CoGe
PGDD synteny : 16064873

Protein [Map View]
MSYSHQSMGSGSRSTRGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLPNIKWICPTAPSRPVSLLGGFP
CTAWFDVGEISEDLHDDIEGLDASAAHIANLLSAEPTDVKVGIGGFSMGAAIALYSTTCYALGRYGTGHPYTINLRATVG
LSGWLPGWRSLRSKIESSNEVARRAASIPIILAHGTSDDVVPYRFGEKSAHSLAMAGFRQTMFKPYEGLGHYTVPKEMDE
VVHWLASRLGLEGSR*

DNA
ATGAGCTATTCTCATCAAAGCATGGGTTCTGGTAGTAGAAGTACAAGGGGCTATGAGTTTGGAAGGACTTATGTTGTGAG
GCCTAAAGGAAAGCACCAAGCTACTATTGTTTGGTTGCATGGTCTTGGAGATAATGGCTCCAGCTCTTCTCAGCTCTTGG
AGAGCCTACCTCTTCCAAACATAAAATGGATTTGTCCAACTGCTCCTTCGCGTCCTGTTTCGCTTCTGGGTGGATTCCCT
TGCACTGCCTGGTTTGACGTGGGAGAAATTTCTGAGGATCTTCATGATGATATAGAAGGCTTAGATGCTTCAGCTGCACA
TATTGCTAACCTCTTATCCGCTGAACCAACAGATGTCAAAGTTGGGATAGGAGGTTTCAGTATGGGTGCAGCAATAGCTC
TCTACTCCACGACGTGCTACGCTCTTGGGCGTTATGGAACCGGACATCCTTATACTATTAACCTACGAGCTACTGTAGGA
CTTAGTGGTTGGCTTCCTGGTTGGAGGAGCTTAAGGAGCAAAATAGAAAGTTCGAATGAGGTTGCAAGGCGCGCTGCATC
GATACCAATCATACTTGCACATGGAACTTCGGATGATGTAGTTCCTTATAGATTTGGAGAAAAATCTGCCCATTCACTTG
CCATGGCTGGATTCCGACAAACTATGTTCAAACCATATGAAGGGCTTGGTCACTATACGGTTCCTAAAGAAATGGATGAG
GTGGTTCACTGGCTCGCCTCAAGGCTTGGTCTCGAGGGCTCACGTTAA