Details for Lyrate rockcress Locus 16064772

Position : sca3 ( 5`- 9243472 .. 9245081 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898531 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064772

Protein [Map View]
MAAFISVDFQNCFIFIFLCLFSIVCYSIFFKKPKDSRGCNLPPSPPSLPIIGHLHLLLSSLSHKSLQKISSKYGPLLHLR
IFNVPIILVSSASVELFVGGTDTSVQTTQWTMAEIINKPDVLVRLREEIDSVVGTSRLIQETDIPNLPYLQAVVKEGLRL
HPPFPLLTRKFEERCEIKGFYIPEKTFLVINAYAWMRDPDSWEDPNEFKPERFLGSSRLGQEDERDEAQKYIPFGGGRRG
CPGSNLASIFIGTAIGVMVQCFDWGIKGDKVNMEETFEGLTLTMVHPLKCTPVPRTQLSF*

DNA
ATGGCAGCGTTTATCAGCGTTGACTTTCAGAACTGTTTCATCTTCATCTTCCTGTGCCTCTTCTCAATCGTCTGTTACTC
TATCTTTTTCAAGAAACCAAAGGACTCACGAGGCTGTAATCTACCTCCCAGCCCTCCGTCTCTTCCAATCATCGGTCATC
TTCACCTTCTCCTCTCTTCTCTATCCCACAAGTCTTTACAGAAAATCTCCTCCAAGTATGGACCCCTCCTCCATCTCCGG
ATTTTTAACGTCCCCATCATCCTTGTTTCGTCTGCCTCAGTGGAGCTTTTCGTGGGAGGCACTGATACCTCGGTGCAAAC
AACACAATGGACAATGGCCGAGATCATTAATAAGCCTGACGTTCTTGTGAGGCTGAGAGAAGAAATCGATTCCGTTGTAG
GGACATCAAGGTTGATTCAAGAAACAGATATACCAAACCTTCCTTATTTGCAAGCGGTGGTTAAGGAAGGACTAAGATTG
CACCCACCATTTCCTCTGCTGACGAGGAAGTTTGAAGAAAGGTGTGAGATCAAAGGGTTCTACATTCCGGAGAAGACATT
TCTTGTTATTAATGCTTATGCTTGGATGAGAGATCCTGATTCCTGGGAAGATCCTAATGAGTTTAAGCCGGAGAGGTTTC
TAGGATCTTCAAGATTAGGACAAGAAGACGAGAGGGACGAAGCTCAGAAGTACATTCCTTTTGGGGGCGGAAGGAGAGGC
TGTCCTGGATCTAATCTAGCTTCTATTTTCATAGGAACCGCGATTGGAGTGATGGTTCAGTGCTTTGACTGGGGAATCAA
AGGAGATAAGGTCAATATGGAAGAGACTTTTGAAGGACTGACCCTTACCATGGTTCATCCACTTAAGTGCACTCCAGTTC
CTCGAACCCAACTTTCTTTTTAA