Details for Lyrate rockcress Locus 16064770

Position : sca3 ( 5`- 4069160 .. 4068839 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064770

Protein [Map View]
MEKISAFFVILFLVSSCMVTMSVGDICQTDRDCVEIGIPRCKRTGKMPICYNGYCSCFAKRPPASTTRNSPSSSTTKFV*

DNA
ATGGAGAAAATTTCAGCATTCTTCGTCATTCTCTTCCTTGTCTCGTCGTGCATGGTAACAATGAGTGTTGGAGATATATG
TCAAACGGACAGAGATTGTGTGGAGATTGGGATTCCAAGATGTAAGAGAACAGGAAAGATGCCGATTTGTTACAACGGAT
ATTGTAGCTGTTTCGCTAAAAGACCTCCTGCTTCCACTACTCGGAACTCTCCTTCTTCATCAACCACCAAATTCGTTTGA