Details for Lyrate rockcress Locus 16064768

Position : sca1 ( 5`- 7608457 .. 7612204 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_889225 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064768

Protein [Map View]
MNRPLEGDCSVEIFGFDSVQGRDTFWHSSAHILGQALEQEYGCKLCIGPCKTIDEGFYYDAFYHGDLGLNDDHFPHIEEG
AAKSALVWLLLVTVICLLNVVCHPIFSVPILFISTSQEGQPFERILVTKDQALEMFSDNLFKVEIINDNLAEDETTTVYR
CGPLVDLCRGPHIPNTSFVKAFKCLKASSAHWKGDKDRESLQRVYGISYPDDKQLKDYLKSIEEAKIYDHRLSGQQQELF
FSHPLSPGNCIYLPHGTRVYNKLMEFFKKEYWKMGYTEVITPVIYTMDFWETSRHAEYYQKNMFKLDFQTPGLTVIHNYG
IKHMNCQGHCLMFRHSVQLPIKLADFGPLYQNEASEDLSGLTRVRQFQQDDAHIFCSETQVKEEVRGILDFVDYAYTKFG
FTYELKLSTRPKKYLGDLEKWDKAEKDLEEALNDFGKTWVKNKGDGEFYGPKIDITVYDAMKRKFQCATIQLDFHLPDRF
KLEYSAEDETEIESSVLIHRAVLGSVERLFAILLEQYKGKLPFWLSPRQAIVCSVSEDSRSYANKVRDQIHEAGYYVDVD
TTDRTVSEKVQEAQVAQYNYILAVGDEEARTGQVTVWLRDEMMSFETLLDEFKLKTANFL*

DNA
ATGAATAGGCCCCTGGAAGGTGATTGTTCGGTAGAGATTTTCGGATTTGATAGCGTCCAAGGCCGTGATACTTTCTGGCA
TTCTAGTGCTCACATTCTAGGCCAGGCTCTCGAGCAGGAGTATGGATGCAAGCTATGCATTGGACCCTGCAAAACCATAG
ATGAGGGTTTCTATTACGATGCATTTTATCATGGCGATCTGGGATTAAACGACGATCATTTTCCACACATCGAAGAAGGT
GCTGCAAAATCTGCTCTGGTATGGCTTCTTCTAGTGACCGTAATATGTTTGCTGAATGTTGTATGTCACCCAATTTTTAG
TGTCCCAATTCTATTTATATCTACATCTCAGGAAGGACAACCATTTGAAAGGATTCTAGTGACCAAAGATCAGGCTCTTG
AGATGTTTTCTGATAATTTATTTAAGGTTGAAATTATCAATGACAACTTGGCTGAAGACGAGACCACTACAGTCTACAGA
TGTGGCCCATTGGTTGATCTGTGTCGTGGACCACATATACCAAATACTTCCTTTGTGAAAGCTTTCAAGTGTTTGAAGGC
TTCATCCGCACACTGGAAAGGTGACAAAGACCGCGAAAGCTTGCAGAGAGTGTATGGGATATCTTATCCGGATGATAAGC
AACTCAAGGACTATCTTAAGTCTATAGAAGAAGCCAAGATATATGACCACAGACTCTCGGGCCAACAGCAGGAACTTTTC
TTTTCTCACCCACTCAGTCCTGGAAATTGTATCTACCTCCCACATGGCACTCGCGTCTATAACAAGTTGATGGAATTCTT
CAAGAAAGAATATTGGAAAATGGGTTACACTGAGGTCATTACACCAGTTATTTACACCATGGATTTCTGGGAAACATCAA
GACATGCTGAATACTACCAGAAAAATATGTTCAAGTTAGATTTTCAAACACCCGGATTGACTGTCATACATAACTACGGG
ATCAAACATATGAATTGCCAGGGTCACTGCTTGATGTTCCGACACAGTGTTCAATTACCCATTAAACTGGCTGACTTTGG
ACCGTTGTATCAAAATGAGGCAAGTGAAGATCTTAGTGGGTTGACCCGTGTCCGACAGTTCCAACAGGATGATGCACACA
TATTCTGTAGCGAGACGCAGGTTAAAGAAGAAGTGAGAGGTATATTGGATTTTGTTGACTATGCTTACACAAAATTTGGC
TTTACCTATGAGCTAAAGCTTTCAACGCGGCCAAAGAAATACCTTGGAGATTTGGAAAAATGGGACAAAGCTGAGAAAGA
TCTTGAAGAAGCACTAAATGATTTTGGAAAGACATGGGTTAAAAACAAAGGAGACGGGGAATTTTATGGCCCAAAGATAG
ACATAACAGTGTATGATGCAATGAAAAGGAAATTCCAGTGTGCTACTATACAGCTTGATTTTCACCTTCCTGATCGCTTC
AAACTGGAATATTCAGCTGAGGATGAAACGGAGATAGAGAGTTCTGTGCTGATACATAGAGCGGTGTTGGGCTCTGTTGA
GCGTCTTTTTGCCATATTGTTGGAACAGTACAAAGGAAAATTGCCCTTCTGGCTTAGTCCCCGCCAGGCCATAGTTTGCT
CTGTTTCAGAGGATTCTCGTTCCTACGCAAACAAGGTGAGAGATCAAATTCACGAAGCTGGCTACTATGTTGATGTTGAC
ACAACAGATAGAACCGTCAGTGAGAAGGTGCAAGAAGCTCAGGTTGCACAGTACAACTACATACTGGCCGTGGGTGATGA
AGAGGCTAGAACGGGACAGGTGACTGTTTGGCTAAGAGACGAAATGATGAGCTTCGAGACTCTGTTGGATGAATTCAAGT
TGAAGACGGCCAACTTTCTCTGA