Details for Lyrate rockcress Locus 16064758

Position : sca3 ( 5`- 5807751 .. 5805172 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897663 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16064758

Protein [Map View]
MVVATTIALYASPPSSVCSTPHQISCDLDLTSRSSSTSPSMVSSPQKPIVGGLSSLFSGASVKSSASSCSYSTGVDEFSS
VRYDRSDDLKDLSLSSSFCYSPAKFVNSSYLRRDLQSPISVLHGPVSCSCSPPMRMSRDRNLDGSFRLGASGLFNGFVRK
ALGSCVDYELGSDSVLVDELTFPMEDGFGVDTRKPYARDLLRRAQLRHKIFKDESVIKAFYEAEKAHRGQMRASGDPYLQ
HCVETAMLLANIGASSTVVVAGLLHDTMDDSFMSYDYILRNFGAGVADLVEGVSKLSQLSKLARENNTACKTVEADRLHT
MFLAMADARAVLIKLADRLHNMKTLYALSPVKQQRFAKETLEIFAPLANRLGISTWKVQLENLCFKHLYPNQHNEMSTML
EDSFDEAMITSAIEKLEQALKKEGISYHVLCGRHKSLYSIYSKMLKKKLTVDEIHDIHGLRLIVDNEGDCYKALGVVHSL
WSEVPGKLKDYITHPKFNGYQSLHTVVMDNGTVPLEVQIRTQEMHLQAEFGFAAHWRYKEGDCKYSSFVLQMVEWARWVV
TWHCEAMSKDRSSISSSDSIKPPCKFPSHSEDCPASYKPNSSQDGPVYVIVIENDKMSVQEFPASSTVSDLLSRAGPGSS
RWSMYGIPAKEELRPRLNQRPVSDLKWKLKMGDVVELTPTIPDESLTEYREEIQRMYDRGLAFSRPGTMVGWGS*

DNA
ATGGTGGTGGCGACGACTATAGCTCTTTACGCGAGCCCACCAAGCAGCGTTTGTTCCACGCCACATCAGATCTCATGTGA
TCTCGATCTGACCTCCAGGAGTTCGTCAACATCCCCTTCCATGGTTTCCTCGCCGCAGAAACCAATCGTCGGTGGTCTCT
CTTCACTTTTCTCCGGCGCATCCGTCAAATCTTCAGCTTCCTCTTGCTCATACTCAACCGGAGTAGATGAGTTTTCTTCA
GTACGCTATGATCGGAGTGATGATTTAAAAGATCTGAGCTTGAGCAGCTCCTTTTGTTATTCTCCGGCGAAATTTGTGAA
TTCTTCGTATCTTAGACGAGATCTTCAAAGTCCTATCTCTGTGCTTCACGGTCCAGTTTCTTGTAGTTGTAGCCCTCCGA
TGAGAATGTCTCGTGATCGGAATCTAGATGGCTCGTTTCGTTTAGGAGCTAGTGGATTGTTCAATGGTTTCGTAAGGAAA
GCTCTAGGATCATGTGTGGATTACGAATTGGGATCGGATTCTGTTCTCGTTGATGAGCTAACGTTTCCTATGGAGGATGG
TTTTGGGGTTGATACGAGAAAGCCATATGCTAGGGATTTGTTAAGACGTGCTCAATTGAGACACAAGATCTTCAAAGATG
AGTCTGTGATCAAAGCATTTTATGAAGCAGAGAAAGCTCACAGAGGACAGATGAGAGCTAGTGGTGATCCTTACCTTCAA
CATTGTGTTGAGACTGCTATGTTGTTGGCTAATATCGGAGCTAGCTCGACTGTTGTTGTTGCTGGGCTTCTTCATGATAC
TATGGATGATTCATTCATGAGCTATGATTATATTCTCAGAAACTTTGGAGCAGGAGTGGCTGATTTGGTCGAAGGGGTTT
CAAAGCTTAGCCAATTGAGCAAACTCGCTAGAGAGAACAATACGGCGTGTAAAACCGTTGAAGCAGATCGATTGCACACA
ATGTTTCTTGCAATGGCAGATGCAAGAGCTGTTCTTATAAAACTGGCTGATCGATTACACAACATGAAGACGCTTTACGC
TTTGTCCCCAGTGAAGCAGCAGAGGTTTGCTAAAGAGACGCTGGAAATATTTGCACCGTTGGCTAATCGTTTGGGAATCT
CTACCTGGAAAGTTCAGCTTGAAAATCTTTGTTTCAAGCATCTTTACCCAAACCAGCATAATGAGATGTCAACCATGCTT
GAGGATTCATTCGACGAAGCCATGATTACTTCTGCAATAGAGAAATTGGAGCAAGCTCTTAAGAAAGAAGGCATTTCTTA
TCATGTTCTGTGTGGCCGGCACAAGAGCTTGTATAGTATTTACAGCAAGATGTTGAAGAAAAAGCTAACTGTGGATGAAA
TTCATGACATTCATGGGTTACGTTTGATTGTTGACAACGAAGGAGATTGTTACAAGGCCTTAGGAGTAGTTCATAGCTTA
TGGTCTGAAGTTCCTGGAAAGCTGAAGGATTACATAACTCATCCCAAATTCAACGGGTATCAATCTTTGCACACGGTAGT
GATGGACAATGGAACAGTCCCACTTGAAGTCCAAATACGTACACAGGAGATGCATTTGCAAGCAGAATTTGGGTTTGCAG
CTCATTGGAGGTACAAGGAAGGTGACTGCAAATACTCTTCGTTTGTGCTTCAGATGGTTGAATGGGCTCGGTGGGTCGTA
ACCTGGCATTGCGAAGCAATGAGCAAAGACCGATCTTCCATAAGTTCTTCTGATTCCATCAAACCCCCTTGCAAGTTTCC
GTCTCACTCCGAGGACTGCCCGGCTTCTTACAAGCCTAACAGTAGCCAGGACGGACCAGTGTACGTCATCGTAATCGAAA
ATGACAAGATGTCTGTGCAAGAATTTCCAGCGAGTTCTACAGTCTCGGATCTGCTAAGCCGGGCGGGGCCAGGGAGCTCG
AGGTGGTCCATGTATGGCATACCAGCAAAGGAAGAACTAAGGCCAAGGCTGAACCAAAGACCTGTAAGTGACCTCAAGTG
GAAGCTGAAGATGGGTGATGTGGTGGAGCTGACTCCAACAATTCCTGACGAGTCTCTGACTGAATACAGAGAAGAGATTC
AACGGATGTATGATCGAGGACTCGCGTTTTCCCGCCCCGGAACCATGGTCGGATGGGGAAGTTGA