Details for Lyrate rockcress Locus 16064750

Position : sca3 ( 5`- 3078906 .. 3076312 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16064750

Protein [Map View]
MLIHIRIPRKILALRRHVFPPYNAFFSVSSRPSQFSSDQVAAHNVASLLKSPNWEKNSSLKSLVSHMSPNVASQVISLQR
SDNDICVRFFMWVCKHSSYCFDPTQKNQLLKLIVSSGLFRVAHDVIVALIRECSRCEKEMLKLISCFDELREVSGFRLNY
PCYSSLLMSLAKLDLGFLAYVTYRRMEADGFVVGMIDYRTIVNALCKNGYTEAAEMFMCKILKVGFLLDSHIVTSLLLGF
CRGLNLRDALKVFDLMSREGTCAPNSVSYSILIHGLCEVGRLEEAFGLKDQMGEKGCQPSTRTYTVLIKALCDRGLIDKA
FNLFDEMIARGCKPNVHTYTVLIDGLCRDGKIEEANGVCRKMVKDGIFPSVITYNALINGYCKDGRVVPAFELLTVMEKR
ACKPNVRTFNELMEGLCRVGKPYKAVHLLKRMLDNGLSPDIVSYNVLIDGLCREGHMNVAYKLLTSMNSFDLEPDCLTFT
AIINAFCKQGKADVASAFLGLMLRKGISLDEVTGTTLIDGVCNVGKTRDALFILETLVKMRMLTTPHSLNVILDMLSKGC
KLKEELAMLGKINKLGLVPSVVTYTTLVDGLIRSGDISGSFRMLELMKLSGCLPNVYPYTIIINGLCQFGRVEEAEKLLS
AMQDSGVSPNHVTYTVMVKGYVNNGKLDRALETVRAMVERGYELNDRIYSSLLRGFVLSQKGIRETDPECIKELISVVEQ
LGGSTSGLCIFLVTRLCKEGRTDESNGLVQTILKSGVFLEKAIDIIMESYCSKKKHTKCVELITLVLKSGFVPSFKSFCL
VIQGLKKEGDTERARELVMELLTSNGVVEKSGVLPYVECLMETGDCSEVIDLVDQLHSRERPTF*

DNA
ATGCTGATACATATCAGAATTCCTCGAAAGATCTTAGCTTTGAGGCGTCATGTTTTTCCGCCTTATAATGCGTTCTTCTC
CGTCTCTTCTCGACCTTCTCAGTTTTCCTCGGACCAAGTGGCGGCTCACAATGTTGCATCTTTACTAAAAAGCCCCAATT
GGGAGAAGAACAGTTCTCTTAAATCTCTAGTCTCTCACATGAGCCCAAATGTCGCTTCACAGGTCATTTCGCTTCAACGC
AGTGACAATGACATTTGCGTTCGCTTTTTCATGTGGGTCTGCAAGCATTCGTCGTACTGTTTTGACCCAACTCAGAAAAA
TCAGCTTTTGAAACTGATTGTTTCTTCCGGATTGTTTCGAGTTGCGCATGATGTTATTGTTGCGTTGATCAGGGAATGTA
GTAGATGCGAGAAAGAGATGTTGAAACTAATAAGTTGTTTTGATGAGCTGAGAGAGGTTTCTGGGTTCCGGTTAAATTAC
CCTTGTTACAGCTCTCTTTTGATGTCCTTGGCTAAACTTGATTTAGGATTTTTAGCTTACGTGACTTACAGAAGAATGGA
AGCTGACGGATTTGTTGTTGGTATGATTGATTATAGAACCATTGTCAATGCTCTGTGTAAGAATGGATACACGGAAGCCG
CTGAGATGTTCATGTGTAAGATTCTTAAAGTTGGGTTTCTGTTAGATTCCCATATAGTCACTTCTCTGTTGCTGGGTTTT
TGCCGTGGATTGAACCTTAGAGATGCACTCAAGGTGTTTGATTTAATGTCTAGGGAGGGAACTTGTGCACCAAACTCTGT
TAGTTACTCCATTTTGATTCACGGGTTGTGTGAAGTAGGGAGACTTGAAGAAGCCTTTGGCTTAAAAGATCAAATGGGTG
AGAAAGGTTGCCAACCAAGCACACGTACATATACTGTGCTTATTAAAGCCTTGTGCGATAGAGGTTTGATTGATAAAGCT
TTTAACTTGTTTGATGAGATGATTGCTAGAGGGTGCAAACCAAACGTTCACACTTACACCGTTTTGATTGATGGGTTATG
TAGAGACGGAAAGATTGAAGAGGCTAATGGGGTTTGTCGAAAGATGGTTAAAGACGGGATATTTCCCAGTGTAATAACTT
ACAATGCGTTGATAAATGGCTACTGCAAAGATGGACGGGTTGTTCCCGCTTTTGAGCTTCTTACTGTAATGGAGAAGAGG
GCTTGCAAACCAAATGTAAGAACTTTTAACGAGCTTATGGAAGGGTTGTGTAGAGTTGGGAAACCGTACAAGGCCGTGCA
CCTTTTGAAGAGAATGCTGGACAATGGCCTGTCACCTGACATTGTGAGCTATAATGTTTTGATCGATGGGCTTTGTAGAG
AAGGCCATATGAATGTGGCGTACAAGCTACTTACCTCGATGAACTCCTTTGACCTTGAGCCTGATTGTCTTACATTCACC
GCTATAATAAATGCTTTCTGCAAACAAGGGAAGGCTGACGTTGCTAGCGCATTCTTAGGTTTGATGCTTAGAAAAGGAAT
AAGCCTAGATGAAGTAACAGGTACAACTCTTATTGATGGTGTCTGCAATGTCGGTAAAACCCGTGACGCATTGTTTATCC
TGGAGACGTTGGTTAAAATGAGAATGTTGACAACTCCTCACTCCCTGAACGTGATTCTTGATATGCTCAGTAAAGGTTGT
AAACTGAAGGAGGAATTAGCAATGCTTGGGAAAATCAATAAGCTTGGTTTAGTTCCTTCTGTAGTGACTTACACAACATT
GGTTGATGGGTTGATTCGATCAGGTGATATTAGCGGTTCCTTCAGGATGCTAGAACTGATGAAGTTAAGTGGTTGTTTGC
CGAATGTCTATCCATACACAATCATCATCAATGGTCTTTGTCAATTTGGGAGAGTCGAGGAAGCAGAGAAGCTTCTTTCT
GCTATGCAAGATTCAGGAGTTTCACCAAACCATGTTACTTATACCGTTATGGTGAAAGGATATGTCAATAATGGAAAACT
AGACCGTGCTCTTGAAACAGTAAGAGCAATGGTTGAAAGAGGATATGAACTAAATGACCGTATCTATTCTTCTTTGTTAC
GGGGATTTGTCTTATCTCAAAAAGGTATTAGAGAAACCGATCCTGAATGTATCAAAGAACTCATATCTGTGGTAGAACAA
CTTGGTGGGTCTACCAGCGGGTTATGTATTTTCTTGGTCACACGGTTATGCAAAGAGGGAAGAACGGATGAGTCCAACGG
TCTAGTCCAAACTATACTCAAGAGCGGTGTTTTTCTCGAGAAGGCCATCGACATCATCATGGAATCTTATTGCAGCAAGA
AGAAACACACCAAGTGTGTGGAGCTGATAACACTTGTTCTCAAATCCGGGTTTGTCCCGAGTTTCAAATCTTTCTGCCTA
GTGATTCAAGGTTTGAAGAAGGAAGGAGATACAGAGCGGGCGCGTGAGCTCGTAATGGAGCTTCTTACCTCGAATGGAGT
TGTAGAGAAAAGTGGAGTGTTGCCTTATGTTGAGTGTCTCATGGAAACTGGTGATTGCAGTGAAGTCATAGATTTGGTGG
ATCAATTGCACAGCAGAGAAAGACCCACCTTCTAA