Details for Lyrate rockcress Locus 16064743

Position : sca3 ( 5`- 3537933 .. 3540007 -3` )
Annotation : [B2G] electron transport sco1 family protein
External links : CoGe
PGDD synteny : 16064743

Protein [Map View]
MASALCRTASRLRSIQICRRIRVSSDLLSASSPFPACISDALRHGDFSLPRSFFSLNCGIEMMKMDQRCLLSTSASDTTS
KPDSGKSETKSSVKNEKSGGSESSDGGSDQRNNRASGKDVRGGPVSWMSFFLLFATGAGLVYYYDREKKRHIEDINKNSI
AVKEGPSAGKAAIGGPFNLIRDDGKRVTEKDLMGKWSILYFGFTHCPDICPDELIKLAAAIDKIKENSGVDVVPVFISVD
PERDTVQQVHEYVKEFHPKLIGLTGSPEEIKSVARSYRVYYMKTEEEDSDYLVDHSIVMYLMSPEMNFVKFYGKNHDVDS
LTDGVVKEIRQYRK*

DNA
ATGGCGTCTGCTCTATGTAGAACTGCAAGCCGTCTTCGTTCCATTCAAATTTGTCGTCGGATTCGCGTCTCGAGCGATCT
ACTATCGGCATCGTCTCCTTTTCCGGCGTGCATCTCCGACGCGCTTCGTCATGGAGATTTCTCTCTTCCTCGATCGTTTT
TTTCACTTAACTGTGGAATTGAAATGATGAAGATGGATCAGAGATGTTTGCTGAGTACTTCTGCTTCTGACACTACATCG
AAACCTGACTCCGGTAAATCGGAAACAAAATCTTCCGTTAAGAATGAGAAATCTGGAGGATCAGAGAGTTCTGATGGTGG
TTCAGATCAGAGAAACAACCGTGCTTCTGGAAAAGACGTTCGTGGAGGGCCGGTTTCATGGATGAGCTTTTTCTTGCTGT
TTGCTACTGGAGCTGGATTGGTCTACTATTATGATAGAGAAAAGAAACGTCATATCGAAGATATAAATAAGAATTCTATA
GCCGTCAAGGAGGGACCATCTGCAGGAAAAGCAGCCATTGGAGGACCATTCAACCTTATAAGAGACGATGGGAAACGTGT
GACGGAGAAAGACTTGATGGGAAAATGGTCCATCTTATACTTTGGTTTCACTCATTGTCCCGATATCTGTCCTGACGAGC
TTATTAAGTTAGCTGCTGCCATTGACAAAATTAAGGAAAATTCGGGAGTAGACGTGGTGCCAGTGTTTATCTCTGTGGAT
CCTGAAAGAGACACAGTTCAGCAAGTACATGAATATGTCAAAGAATTTCACCCGAAATTGATCGGGTTAACCGGGAGCCC
TGAAGAAATCAAATCGGTGGCCCGATCTTACCGGGTTTACTACATGAAGACTGAAGAGGAAGATTCAGACTATCTCGTTG
ATCACTCTATAGTCATGTACTTGATGAGTCCGGAGATGAATTTTGTGAAATTTTACGGGAAGAATCACGATGTTGACTCG
TTGACCGATGGCGTTGTAAAAGAGATCCGACAGTACCGGAAGTAA